Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ELF3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit anti-Human, Mouse ELF3 Polyclonal Antibody | anti-ELF3 antibody

ELF3 Polyclonal Antibody

Gene Names
ELF3; ERT; ESX; EPR-1; ESE-1
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Purity
Affinity Purification
Synonyms
ELF3; Polyclonal Antibody; ELF3 Polyclonal Antibody; EPR-1; ERT; ESE-1; ESX; anti-ELF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSK
Sequence Length
371
Applicable Applications for anti-ELF3 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:200
IP: 1:20 - 1:50
Immunogen
Recombinant protein of human ELF3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Positive Samples
Mouse skin, Mouse lung, SGC-7901, HT-29, SW480
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ELF3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ELF3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse heart using ELF3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse heart using ELF3 antibody at dilution of 1:100 (40x lens).)

Immunoprecipitation (IP)

(Immunoprecipitation analysis of 150ug extracts of A549 cells using 3ug ELF3 antibody. Western blot was performed from the immunoprecipitate using ELF3 antibody at a dilition of 1:500.)

Immunoprecipitation (IP) (Immunoprecipitation analysis of 150ug extracts of A549 cells using 3ug ELF3 antibody. Western blot was performed from the immunoprecipitate using ELF3 antibody at a dilition of 1:500.)
Product Categories/Family for anti-ELF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 39kDa; 41kDa
Observed: 41kDa
NCBI Official Full Name
ETS-related transcription factor Elf-3
NCBI Official Synonym Full Names
E74 like ETS transcription factor 3
NCBI Official Symbol
ELF3
NCBI Official Synonym Symbols
ERT; ESX; EPR-1; ESE-1
NCBI Protein Information
ETS-related transcription factor Elf-3
UniProt Protein Name
ETS-related transcription factor Elf-3
Protein Family
UniProt Gene Name
ELF3
UniProt Synonym Gene Names
ESE-1

Uniprot Description

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development ().

Research Articles on ELF3

Similar Products

Product Notes

The ELF3 elf3 (Catalog #AAA9133529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELF3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ELF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:200 IP: 1:20 - 1:50. Researchers should empirically determine the suitability of the ELF3 elf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATCEISNI FSNYFSAMYS SEDSTLASVP PAATFGADDL VLTLSNPQMS LEGTEKASWL GEQPQFWSKT QVLDWISYQV EKNKYDASAI DFSRCDMDGA TLCNCALEEL RLVFGPLGDQ LHAQLRDLTS SSSDELSWII ELLEKDGMAF QEALDPGPFD QGSPFAQELL DDGQQASPYH PGSCGAGAPS PGSSDVSTAG TGASRSSHSS DSGGSDVDLD PTDGKLFPSD GFRDCKKGDP KHGKRKRGRP RKLSK. It is sometimes possible for the material contained within the vial of "ELF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.