Rabbit anti-Mouse KCTD12 Polyclonal Antibody | anti-KCTD12 antibody
KCTD12 Polyclonal Antibody
Gene Names
KCTD12; PFET1; PFETIN; C13orf2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KCTD12; Polyclonal Antibody; KCTD12 Polyclonal Antibody; C13orf2; PFET1; PFETIN; anti-KCTD12 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE
Sequence Length
325
Applicable Applications for anti-KCTD12 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human KCTD12
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, postsynaptic cell membrane, presynaptic cell membrane, synapse
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-KCTD12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
BTB/POZ domain-containing protein KCTD12
NCBI Official Synonym Full Names
potassium channel tetramerization domain containing 12
NCBI Official Symbol
KCTD12
NCBI Official Synonym Symbols
PFET1; PFETIN; C13orf2
NCBI Protein Information
BTB/POZ domain-containing protein KCTD12
UniProt Protein Name
BTB/POZ domain-containing protein KCTD12
Protein Family
UniProt Gene Name
KCTD12
UniProt Synonym Gene Names
C13orf2; KIAA1778; PFET1
Uniprot Description
Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization ().
Research Articles on KCTD12
Similar Products
Product Notes
The KCTD12 kctd12 (Catalog #AAA9133011) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCTD12 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCTD12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the KCTD12 kctd12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TPSQSLDGSR RSGYITIGYR GSYTIGRDAQ ADAKFRRVAR ITVCGKTSLA KEVFGDTLNE SRDPDRPPER YTSRYYLKFN FLEQAFDKLS ESGFHMVACS STGTCAFASS TDQSEDKIWT SYTEYVFCRE. It is sometimes possible for the material contained within the vial of "KCTD12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
