parainfluenza 1 virus Nucleoprotein (N) Recombinant Protein | N recombinant protein
Recombinant Human parainfluenza 1 virus Nucleoprotein (N)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
parainfluenza 1 virus Nucleoprotein (N); Recombinant Human parainfluenza 1 virus Nucleoprotein (N); Nucleoprotein(Nucleocapsid protein)(NP)(Protein N); N recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-524aa, Full Length
Sequence
MAGLLSTFDTFSSRRSESINKSGGGAIIPGQRSTVSVFILGPSVTDDADKLLIATTFLAHSLDTDKQHSQRGGFLVSLLAMAYSSPELYLTTNGVNADVKYVIYNIERDPKRTKTDGFIVKTRDMEYERTTEWLFGPMINKNPLFQGQRENADLEALLQTYGYPACLGAIIVQVWIVLVKAITSSSGLRKGFFNRLEAFRQDGTVKSALVFTGDTVEGIGAVMRSQQSLVSLMVETLVTMNTSRSDLTTLEKNIQIVGNYIRESGLASFMNTIKYGVETKMAALTLSNLRPDINKLRSLVDIYLSKGARAPFTCILRDPVHGEFAPGNYPALWSYAMGVAVVQNKAMQQYVTGRTYLDMEMFLLGQAVAKDADSKISSALEEELGVTDTAKERLRHHLTNLSGGDGAYHKPTGGGAIEVAIDHTDITFGAEDTADRDNKNWTNNSNERWMNHSINNHTITISGAEELEEETNDEDITDIENKIARRLADRKQRLSQANNRQDASSDADHENDDDATAAAGIGGI
Species
Human parainfluenza 1 virus (strain C39)(HPIV-1)
Relevance
Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for N recombinant protein
References
"Sequence analysis and expression of the human parainfluenza type 1 virus nucleoprotein gene."Matsuoka Y., Ray R.Virology 181:403-407(1991)
NCBI and Uniprot Product Information
Uniprot Description
Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases ().
Similar Products
Product Notes
The parainfluenza 1 virus Nucleoprotein (N) n (Catalog #AAA9018556) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-524aa, Full Length. The amino acid sequence is listed below: MAGLLSTFDT FSSRRSESIN KSGGGAIIPG QRSTVSVFIL GPSVTDDADK LLIATTFLAH SLDTDKQHSQ RGGFLVSLLA MAYSSPELYL TTNGVNADVK YVIYNIERDP KRTKTDGFIV KTRDMEYERT TEWLFGPMIN KNPLFQGQRE NADLEALLQT YGYPACLGAI IVQVWIVLVK AITSSSGLRK GFFNRLEAFR QDGTVKSALV FTGDTVEGIG AVMRSQQSLV SLMVETLVTM NTSRSDLTTL EKNIQIVGNY IRESGLASFM NTIKYGVETK MAALTLSNLR PDINKLRSLV DIYLSKGARA PFTCILRDPV HGEFAPGNYP ALWSYAMGVA VVQNKAMQQY VTGRTYLDME MFLLGQAVAK DADSKISSAL EEELGVTDTA KERLRHHLTN LSGGDGAYHK PTGGGAIEVA IDHTDITFGA EDTADRDNKN WTNNSNERWM NHSINNHTIT ISGAEELEEE TNDEDITDIE NKIARRLADR KQRLSQANNR QDASSDADHE NDDDATAAAG IGGI. It is sometimes possible for the material contained within the vial of "parainfluenza 1 virus Nucleoprotein (N), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
