Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Trypsin-2 Recombinant Protein | PRSS2 recombinant protein

Recombinant Human Trypsin-2 (PRSS2)(K23Q,S167G), partial

Gene Names
PRSS2; TRY2; TRY8; TRYP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trypsin-2; Recombinant Human Trypsin-2 (PRSS2)(K23Q; S167G); partial; Trypsin-2(EC 3.4.21.4)(Anionic trypsinogen)(Serine protease 2)(Trypsin II); PRSS2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-247aa(K23Q, S167G), Partial
Sequence
APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Species
Homo sapiens (Human)
Relevance
In the ileum, may be involved in defensin processing, including DEFA5.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for PRSS2 recombinant protein
References
"Paneth cell trypsin is the processing enzyme for human defensin-5."Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L.Nat. Immunol. 3:583-590(2002)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,488 Da
NCBI Official Full Name
protease, serine, 2 (trypsin 2), isoform CRA_b
NCBI Official Synonym Full Names
protease, serine, 2 (trypsin 2)
NCBI Official Symbol
PRSS2
NCBI Official Synonym Symbols
TRY2; TRY8; TRYP2
NCBI Protein Information
trypsin-2; trypsin 2; trypsin II; trypsinogen 2; serine protease 2; anionic trypsinogen; protease serine 2 preproprotein; protease, serine, 2, preproprotein
UniProt Protein Name
Trypsin-2
Protein Family
UniProt Gene Name
PRSS2
UniProt Synonym Gene Names
TRY2; TRYP2
UniProt Entry Name
TRY2_HUMAN

NCBI Description

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

trypsin 2: In the ileum, may be involved in defensin processing, including DEFA5. Belongs to the peptidase S1 family.

Protein type: Secreted; Extracellular matrix; Secreted, signal peptide; Calcium-binding; EC 3.4.21.4; Protease; Cell adhesion

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; serine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; digestion; innate immune response; proteolysis; positive regulation of cell growth

Disease: Pancreatitis, Hereditary

Research Articles on PRSS2

Similar Products

Product Notes

The PRSS2 prss2 (Catalog #AAA9018519) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-247aa(K23Q, S167G), Partial. The amino acid sequence is listed below: APFDDDDQIV GGYICEENSV PYQVSLNSGY HFCGGSLISE QWVVSAGHCY KSRIQVRLGE HNIEVLEGNE QFINAAKIIR HPKYNSRTLD NDILLIKLSS PAVINSRVSA ISLPTAPPAA GTESLISGWG NTLSSGADYP DELQCLDAPV LGQAECEASY PGKITNNMFC VGFLEGGKDS CQGDSGGPVV SNGELQGIVS WGYGCAQKNR PGVYTKVYNY VDWIKDTIAA NS. It is sometimes possible for the material contained within the vial of "Trypsin-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.