Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB)

IRF3 recombinant protein

IRF3, human recombinant

Purity
>=95% by SDS-PAGE
Synonyms
IRF3; human recombinant; Interferon regulatory factor-3; IRF3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>=95% by SDS-PAGE
Form/Format
Liquid. 1mg/ml in Phosphate-buffered saline (pH7.4) .
Concentration
1mg/ml (varies by lot)
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Gene Source
Human
Endotoxin
<1.0 EU per 1 microgram of protein
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -80 degree C.
Centrifuge the vial prior to opening.
Shipping: Dry Ice
Shelf life: ~12 months

Western Blot (WB)

Western Blot (WB)
Related Product Information for IRF3 recombinant protein
Members of the Interferon regulatory factor (IRF) family regulate gene expression critical to immune response, hemopoiesis, and proliferation. IRF-3 is a member of the IRF family, and is distinct from other family members. Its transcriptional activity is regulated solely by posttranslational modifications. It plays a crucial role in activation of innate immunity and inflammation in response to viral infection. Recombinant human IRF3 was expressed in E Coli and purified by using conventional chromatography techniques. Plays a crucial role in activation of innate immunity and inflammation in response to viral infection

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,219 Da
NCBI Official Full Name
interferon regulatory factor 3 isoform 4
NCBI Official Synonym Full Names
interferon regulatory factor 3
NCBI Official Symbol
IRF3
NCBI Protein Information
interferon regulatory factor 3
UniProt Protein Name
Interferon regulatory factor 3
UniProt Gene Name
IRF3
UniProt Synonym Gene Names
IRF-3
UniProt Entry Name
IRF3_HUMAN

NCBI Description

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

IRF3: interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; DNA binding; transcription cofactor activity; transcription factor activity

Biological Process: negative regulation of interferon-beta biosynthetic process; transcription from RNA polymerase II promoter; positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; apoptosis; cytokine and chemokine mediated signaling pathway; MyD88-independent toll-like receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; toll-like receptor 3 signaling pathway; negative regulation of defense response to virus by host; response to exogenous dsRNA; positive regulation of interferon type I production; lipopolysaccharide-mediated signaling pathway; positive regulation of interferon-beta production; toll-like receptor signaling pathway; innate immune response; interferon type I biosynthetic process; toll-like receptor 4 signaling pathway; response to DNA damage stimulus; negative regulation of interferon type I production; defense response to virus; positive regulation of interferon-alpha production; positive regulation of cytokine secretion

Disease: Herpes Simplex Encephalitis, Susceptibility To, 7

Research Articles on IRF3

Similar Products

Product Notes

The IRF3 irf3 (Catalog #AAA847119) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGTPKPRILP WLVSQLDLGQ LEGVAWVNKS RTRFRIPWKH GLRQDAQQED FGIFQAWAEA TGAYVPGRDK PDLPTWKRNF RSALNRKEGL RLAEDRSKDP HDPHKIYEFV NS. It is sometimes possible for the material contained within the vial of "IRF3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.