Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DRB1 antibody (MBS839853) used at 1.25 ug/ml to detect target protein.)

Rabbit DRB1 Polyclonal Antibody | anti-DRB1 antibody

DRB1 antibody

Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
DRB1; Polyclonal Antibody; DRB1 antibody; Polyclonal DRB1; Anti-DRB1; Developmentally Regulated Rna-Binding Protein 1; anti-DRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
DRB1 antibody was raised against the N terminal of DRB1
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DRB1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
237
Applicable Applications for anti-DRB1 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(DRB1 antibody (MBS839853) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (DRB1 antibody (MBS839853) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-DRB1 antibody
Rabbit polyclonal DRB1 antibody raised against the N terminal of DRB1
Product Categories/Family for anti-DRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
DRB1, partial
UniProt Protein Name
HLA class II histocompatibility antigen, DRB1-1 beta chain
UniProt Gene Name
HLA-DRB1
UniProt Synonym Gene Names
DR-1; DR1
UniProt Entry Name
2B11_HUMAN

Uniprot Description

HLA-DRB1: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route; where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules; and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments; exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides; autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs; other cells of the gastrointestinal tract; such as epithelial cells; express MHC class II molecules and CD74 and act as APCs; which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen; three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs; CD74 undergoes a sequential degradation by various proteases; including CTSS and CTSL; leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells; the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal miroenvironment has been implicated in the regulation of antigen loading into MHC II molecules; increased acidification produces increased proteolysis and efficient peptide loading. Genetic variation in HLA-DRB1 is a cause of susceptibility to sarcoidosis type 1 (SS1). Sarcoidosis is an idiopathic, systemic, inflammatory disease characterized by the formation of immune granulomas in involved organs. Granulomas predominantly invade the lungs and the lymphatic system, but also skin, liver, spleen, eyes and other organs may be involved. Belongs to the MHC class II family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; cell surface; membrane; integral to plasma membrane; late endosome membrane; lysosomal membrane; plasma membrane; trans-Golgi network membrane; external side of plasma membrane; MHC class II protein complex

Molecular Function: MHC class II receptor activity; peptide antigen binding

Biological Process: T-helper 1 type immune response; detection of bacterium; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class II; immunoglobulin production during immune response; T cell receptor signaling pathway; polysaccharide assembly with MHC class II protein complex; humoral immune response mediated by circulating immunoglobulin; negative regulation of T cell proliferation; inflammatory response to antigenic stimulus; peptide antigen assembly with MHC class II protein complex; regulation of interleukin-4 production; negative regulation of interferon-gamma production; T cell costimulation; immune response; protein tetramerization

Disease: Rheumatoid Arthritis; Sarcoidosis, Susceptibility To, 1; Multiple Sclerosis, Susceptibility To

Similar Products

Product Notes

The DRB1 hla-drb1 (Catalog #AAA839853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRB1 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's DRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the DRB1 hla-drb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.