Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (B3GALNT1 antibody (MBS839775) used at 1 ug/ml to detect target protein.)

Rabbit B3GALNT1 Polyclonal Antibody | anti-B3GALNT1 antibody

B3GALNT1 antibody

Gene Names
B3GALNT1; P; P1; GLOB; GLCT3; galT3; Gb4Cer; B3GALT3; beta3Gal-T3
Applications
Western Blot
Purity
Affinity purified
Synonyms
B3GALNT1; Polyclonal Antibody; B3GALNT1 antibody; Polyclonal B3GALNT1; Anti-B3GALNT1; P; B3GALT3; galT3; Globoside Blood Group; Gb4Cer; beta3Gal-T3; BGAL-3; Beta 13-N-Acetylgalactosaminyltransferase 1; BGAL 3; GLCT3; GLOB; P1; B3GAL; anti-B3GALNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALNT1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
331
Applicable Applications for anti-B3GALNT1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.
Cross-Reactivity
Human
Immunogen
B3GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(B3GALNT1 antibody (MBS839775) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (B3GALNT1 antibody (MBS839775) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-B3GALNT1 antibody
Rabbit polyclonal B3GALNT1 antibody
Product Categories/Family for anti-B3GALNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
B3GALNT1, partial
NCBI Official Synonym Full Names
beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
NCBI Official Symbol
B3GALNT1
NCBI Official Synonym Symbols
P; P1; GLOB; GLCT3; galT3; Gb4Cer; B3GALT3; beta3Gal-T3
NCBI Protein Information
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
UniProt Protein Name
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
UniProt Gene Name
B3GALNT1
UniProt Synonym Gene Names
B3GALT3; Beta-1,3-GalNAc-T1; Beta-1,3-GalTase 3; Beta3Gal-T3; Beta3GalT3; b3Gal-T3
UniProt Entry Name
B3GL1_HUMAN

NCBI Description

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). The encoded protein of this gene does not use N-acetylglucosamine as an acceptor sugar at all. Multiple transcript variants that are alternatively spliced in the 5' UTR have been described; they all encode the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

B3GALT3: Transfers N-acetylgalactosamine onto globotriaosylceramide. Belongs to the glycosyltransferase 31 family.

Protein type: Transferase; Membrane protein, integral; Glycan Metabolism - glycosphingolipid biosynthesis - globo series; EC 2.4.1.79

Chromosomal Location of Human Ortholog: 3q25

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity; galactosylgalactosylglucosylceramide beta-D-acetylgalactosaminyltransferase activity

Biological Process: oligosaccharide biosynthetic process; protein amino acid glycosylation

Disease: Blood Group, Globoside System; Blood Group, P1pk System

Research Articles on B3GALNT1

Similar Products

Product Notes

The B3GALNT1 b3galnt1 (Catalog #AAA839775) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's B3GALNT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the B3GALNT1 b3galnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "B3GALNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.