Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MFRP antibody (MBS839542) used at 1 ug/ml to detect target protein.)

Rabbit MFRP Polyclonal Antibody | anti-MFRP antibody

MFRP antibody

Gene Names
MFRP; RD6; NNO2; MCOP5
Applications
Western Blot
Purity
Affinity purified
Synonyms
MFRP; Polyclonal Antibody; MFRP antibody; Polyclonal MFRP; Anti-MFRP; FLJ30570; NNO2; rd6; Membrane Frizzled-Related Protein; anti-MFRP antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
MFRP antibody was raised against the N terminal of MFRP
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFRP antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
579
Applicable Applications for anti-MFRP antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.
Cross-Reactivity
Human
Immunogen
MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids  TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(MFRP antibody (MBS839542) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (MFRP antibody (MBS839542) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MFRP antibody
Rabbit polyclonal MFRP antibody raised against the N terminal of MFRP
Product Categories/Family for anti-MFRP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
membrane frizzled-related protein
NCBI Official Synonym Full Names
membrane frizzled-related protein
NCBI Official Symbol
MFRP
NCBI Official Synonym Symbols
RD6; NNO2; MCOP5
NCBI Protein Information
membrane frizzled-related protein
UniProt Protein Name
Membrane frizzled-related protein
UniProt Gene Name
MFRP
UniProt Entry Name
MFRP_HUMAN

NCBI Description

This gene encodes a member of the frizzled-related protein family. The encoded protein plays an important role in eye development and mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic transcript which also encodes C1q and tumor necrosis factor related protein 5 (C1QTNF5). [provided by RefSeq, Jun 2013]

Uniprot Description

MFRP: May play a role in eye development. Defects in MFRP are the cause of nanophthalmos 2 (NNO2). NNO2 is a rare autosomal recessive disorder of eye development characterized by extreme hyperopia and small functional eyes. Defects in MFRP are the cause of microphthalmia isolated type 5 (MCOP5). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. MCOP5 is characterized by posterior microphthalmia, retinitis pigmentosa, foveoschisis and optic disc drusen.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: apical plasma membrane; integral to membrane

Biological Process: embryonic development

Disease: Microphthalmia, Isolated 5; Nanophthalmos 2

Research Articles on MFRP

Similar Products

Product Notes

The MFRP mfrp (Catalog #AAA839542) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MFRP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MFRP mfrp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MFRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.