Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C19ORF46 antibody (MBS839136) used at 1 ug/ml to detect target protein.)

Rabbit C19ORF46 Polyclonal Antibody | anti-C19ORF46 antibody

C19ORF46 antibody

Gene Names
SYNE4; Nesp4; DFNB76; C19orf46
Applications
Western Blot
Purity
Affinity purified
Synonyms
C19ORF46; Polyclonal Antibody; C19ORF46 antibody; Polyclonal C19ORF46; Anti-C19ORF46; Chromosome 19 ORF; Chromosome ORF 19; FLJ36445; Chromosome ORF-19; anti-C19ORF46 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C19ORF46 antibody was raised against the N terminal Of C19Orf46
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF46 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
291
Applicable Applications for anti-C19ORF46 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.
Cross-Reactivity
Human
Immunogen
C19ORF46 antibody was raised using the N terminal Of C19Orf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C19ORF46 antibody (MBS839136) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C19ORF46 antibody (MBS839136) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C19ORF46 antibody
Rabbit polyclonal C19ORF46 antibody raised against the N terminal Of C19Orf46
Product Categories/Family for anti-C19ORF46 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43 kDa (MW of target protein)
NCBI Official Full Name
C19orf46 protein
NCBI Official Synonym Full Names
spectrin repeat containing, nuclear envelope family member 4
NCBI Official Symbol
SYNE4
NCBI Official Synonym Symbols
Nesp4; DFNB76; C19orf46
NCBI Protein Information
nesprin-4
UniProt Protein Name
Nesprin-4
UniProt Gene Name
SYNE4
UniProt Synonym Gene Names
C19orf46
UniProt Entry Name
SYNE4_HUMAN

NCBI Description

This gene is a member of the nesprin family of genes, that encode KASH (Klarsicht, Anc-1, Syne Homology) domain-containing proteins. In addition to the KASH domain, this protein also contains a coiled-coil and leucine zipper region, a spectrin repeat, and a kinesin-1 binding region. This protein localizes to the outer nuclear membrane, and is part of the linker of nucleoskeleton and cytoskeleton (LINC) complex in the nuclear envelope. LINC complexes are formed by SUN (Sad1, UNC-84)-KASH pairs, and are thought to mechanically couple nuclear components to the cytoskeleton. Mutations in this gene have been associated with progressive high-frequency hearing loss. The absence of this protein in mice also caused hearing loss, and changes in hair cell morphology in the ears. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]

Uniprot Description

AI428936: Contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus. Belongs to the nesprin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.12

Biological Process: establishment of epithelial cell polarity

Disease: Deafness, Autosomal Recessive 76

Research Articles on C19ORF46

Similar Products

Product Notes

The C19ORF46 syne4 (Catalog #AAA839136) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C19ORF46 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C19ORF46 syne4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C19ORF46, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.