39S ribosomal protein L55, mitochondrial (MRPL55) Recombinant Protein | MRPL55 recombinant protein
Recombinant Bovine 39S ribosomal protein L55, mitochondrial (MRPL55)
Gene Names
MRPL55; L55mt
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
39S ribosomal protein L55; mitochondrial (MRPL55); Recombinant Bovine 39S ribosomal protein L55; MRPL55 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-126, Full length protein
Sequence
DCNRASLTRVHRQTYARLYPILLVKQDGSTIHIRYPEPRRILTMPVDLDSLSPEERRARFRKREGQLKEKKEEPELADDFDVEQYKQFWTKK
Sequence Length
92
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MRPL55 recombinant protein
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
15,008 Da
NCBI Official Full Name
39S ribosomal protein L55, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L55
NCBI Official Symbol
MRPL55
NCBI Official Synonym Symbols
L55mt
NCBI Protein Information
39S ribosomal protein L55, mitochondrial
UniProt Protein Name
39S ribosomal protein L55, mitochondrial
Protein Family
UniProt Gene Name
MRPL55
UniProt Synonym Gene Names
L55mt; MRP-L55
Similar Products
Product Notes
The MRPL55 mrpl55 (Catalog #AAA718531) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-126, Full length protein. The amino acid sequence is listed below: DCNRASLTRV HRQTYARLYP ILLVKQDGST IHIRYPEPRR ILTMPVDLDS LSPEERRARF RKREGQLKEK KEEPELADDF DVEQYKQFWT KK. It is sometimes possible for the material contained within the vial of "39S ribosomal protein L55, mitochondrial (MRPL55), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
