Cyclic AMP-dependent transcription factor ATF-3 (Atf3) Recombinant Protein | Atf3 recombinant protein
Recombinant Rat Cyclic AMP-dependent transcription factor ATF-3 (Atf3)
Gene Names
Atf3; LRFI; LRF-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclic AMP-dependent transcription factor ATF-3 (Atf3); Recombinant Rat Cyclic AMP-dependent transcription factor ATF-3 (Atf3); Atf3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181, Full length protein
Sequence
MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTINNRPLEMSVTKSEVAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Sequence Length
181
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Atf3 recombinant protein
Activating transcription factor 3 is a member of the mammalian activation transcription factor
cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.
cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,764 Da
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-3
NCBI Official Synonym Full Names
activating transcription factor 3
NCBI Official Symbol
Atf3
NCBI Official Synonym Symbols
LRFI; LRF-1
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-3
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-3
Protein Family
UniProt Gene Name
Atf3
UniProt Synonym Gene Names
Lrf1; cAMP-dependent transcription factor ATF-3; LRF-1
NCBI Description
expression is associated with neuronal injury [RGD, Feb 2006]
Uniprot Description
In solution, it binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters but also has affinity for related sites. May have a unique and critical role in growth regulation of regenerating liver and mitogen-stimulated cells.
Research Articles on Atf3
Similar Products
Product Notes
The Atf3 atf3 (Catalog #AAA718478) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181, Full length protein. The amino acid sequence is listed below: MMLQHPGQVS ASEVSATAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ NKHLCHRMSS ALESVTINNR PLEMSVTKSE VAPEEDERKR RRRERNKIAA AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S. It is sometimes possible for the material contained within the vial of "Cyclic AMP-dependent transcription factor ATF-3 (Atf3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
