Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ER lumen protein retaining receptor 2 (KDELR2) Recombinant Protein | KDELR2 recombinant protein

Recombinant Human ER lumen protein retaining receptor 2 (KDELR2)

Gene Names
KDELR2; ELP-1; ERD2.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ER lumen protein retaining receptor 2 (KDELR2); Recombinant Human ER lumen protein retaining receptor 2 (KDELR2); Recombinant ER lumen protein retaining receptor 2 (KDELR2); ER lumen protein retaining receptor 2; ERD2-like protein 1; ELP-1 KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2; KDELR2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-212
Sequence
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
Sequence Length
212
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,422 Da
NCBI Official Full Name
ER lumen protein retaining receptor 2 isoform 2
NCBI Official Synonym Full Names
KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
NCBI Official Symbol
KDELR2
NCBI Official Synonym Symbols
ELP-1; ERD2.2
NCBI Protein Information
ER lumen protein retaining receptor 2; KDEL receptor 2; ERD-2-like protein; ERD2-like protein 1; KDEL endoplasmic reticulum protein retention receptor 2; (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
UniProt Protein Name
ER lumen protein retaining receptor 2
UniProt Gene Name
KDELR2
UniProt Synonym Gene Names
ERD2.2; ELP-1
UniProt Entry Name
ERD22_HUMAN

NCBI Description

Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR2 was the second member of the family to be identified, and it encodes a protein which is 83% identical to the KDELR1 gene product. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the ERD2 family.

Similar Products

Product Notes

The KDELR2 kdelr2 (Catalog #AAA718397) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-212. The amino acid sequence is listed below: MNIFRLTGDL SHLAAIVILL LKIWKTRSCA GISGKSQLLF ALVFTTRYLD LFTSFISLYN TSMKVIYLAC SYATVYLIYL KFKATYDGNH DTFRVEFLVV PVGGLSFLVN HDFSPLEILW TFSIYLESVA ILPQLFMISK TGEAETITTH YLFFLGLYRA LYLVNWIWRF YFEGFFDLIA VVAGVVQTIL YCDFFYLYIT KVLKGKKLSL PA. It is sometimes possible for the material contained within the vial of "ER lumen protein retaining receptor 2 (KDELR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.