Myelin P2 Recombinant Protein | PMP2 recombinant protein

Recombinant Human Myelin P2 protein

Cat. Num. AAA717146

• Gene Names: PMP2; P2; MP2; FABP8; M-FABP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myelin P2; Recombinant Human Myelin P2 protein; Peripheral myelin protein 2; PMP2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-132aa; Full Length
• Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
• Sequence Length: 132

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PMP2 recombinant protein

May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Product Categories/Family for PMP2 recombinant protein

Transport

References

Isolation and sequence determination of cDNA encoding P2 protein of human peripheral myelin.Hayasaka K., Nanao K., Tahara M., Sato W., Takada G., Miura M., Uyemura K.Biochem. Biophys. Res. Commun. 181:204-207(1991) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 4505909
• NCBI GeneID: 5375
• NCBI Accession #: NP_002668.1
• NCBI GenBank Nucleotide #: NM_002677.3
• UniProt Accession #: P02689; Q6FHL4
• Molecular Weight: 41.9 kDa
• NCBI Official Full Name: myelin P2 protein
• NCBI Official Synonym Full Names: peripheral myelin protein 2
• NCBI Official Symbol: PMP2
• NCBI Official Synonym Symbols: P2; MP2; FABP8; M-FABP
• NCBI Protein Information: myelin P2 protein
• UniProt Protein Name: Myelin P2 protein
• Protein Family: Myelin P2 protein
• UniProt Gene Name: PMP2
• UniProt Entry Name: MYP2_HUMAN

NCBI Description

The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017]

Uniprot Description

PMP2: May play a role in lipid transport protein in Schwann cells. May bind cholesterol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Chromosomal Location of Human Ortholog: 8q21.3-q22.1

Cellular Component: cytoplasm; myelin sheath

Molecular Function: cholesterol binding; fatty acid binding; protein binding; transporter activity

Biological Process: transport