Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

CTD nuclear envelope phosphatase 1 Recombinant Protein | CTDNEP1 recombinant protein

Recombinant human CTD nuclear envelope phosphatase 1 protein

Gene Names
CTDNEP1; NET56; DULLARD; HSA011916
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CTD nuclear envelope phosphatase 1; Recombinant human CTD nuclear envelope phosphatase 1 protein; Serine/threonine-protein phosphatase dullard; CTDNEP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
RTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Applicable Applications for CTDNEP1 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CTDNEP1 recombinant protein
Serine/threonine phosphatase which may be required for proper nuclear membrane morphology. Involved in LPIN1 dephosphorylation. May antagonize BMP signaling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 KD
NCBI Official Full Name
Homo sapiens CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
CTD nuclear envelope phosphatase 1
NCBI Official Symbol
CTDNEP1
NCBI Official Synonym Symbols
NET56; DULLARD; HSA011916
NCBI Protein Information
CTD nuclear envelope phosphatase 1; dullard homolog; serine/threonine-protein phosphatase dullard; C-terminal domain nuclear envelope phosphatase 1
UniProt Protein Name
CTD nuclear envelope phosphatase 1
UniProt Gene Name
CTDNEP1
UniProt Synonym Gene Names
DULLARD
UniProt Entry Name
CNEP1_HUMAN

Uniprot Description

Function: Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling. Ref.7 Ref.8

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate.

Subunit structure: Interacts with CNEP1R1; the complex dephosphorylates LPIN1 and LPIN2. Ref.8

Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein Ref.2 Ref.7 Ref.8.

Tissue specificity: Muscle specific with lower expression in other metabolic tissues. Ref.8

Sequence similarities: Belongs to the dullard family.Contains 1 FCP1 homology domain.

Biophysicochemical propertiesKinetic parameters:KM=18 mM for p-nitrophenylphosphate Ref.7pH dependence:Optimum pH is 5.5.

Research Articles on CTDNEP1

Similar Products

Product Notes

The CTDNEP1 ctdnep1 (Catalog #AAA717127) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CTD nuclear envelope phosphatase 1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the CTDNEP1 ctdnep1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RTQCLLGLRT FVAFAAKLWS FFIYLLRRQI RTVIQYQTVR YDILPLSPVS RNRLAQVKRK ILVLDLDETL IHSHHDGVLR PTVRPGTPPD FILKVVIDKH PVRFFVHKRP HVDFFLEVVS QWYELVVFTA SMEIYGSAVA DKLDNSRSIL KRRYYRQHCT LELGSYIKDL SVVHSDLSSI VILDNSPGAY RSHPDNAIPI KSWFSDPSDT ALLNLLPMLD ALRFTADVRS VLSRNLHQHR LW. It is sometimes possible for the material contained within the vial of "CTD nuclear envelope phosphatase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.