Proteasome subunit beta type-7 Recombinant Protein | PSMB7 recombinant protein

Recombinant Human Proteasome subunit beta type-7

Cat. Num. AAA717071

• Gene Names: PSMA7; C6; HSPC; RC6-1; XAPC7; HEL-S-276
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proteasome subunit beta type-7; Recombinant Human Proteasome subunit beta type-7; Proteasome subunit R; C6-1; Proteasome subunit XAPC7; PSMB7 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 44-275aa; Partial
• Sequence: GVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
• Sequence Length: 248

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PSMB7 recombinant protein

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Plays an important role in the regulation of cell proliferation or cell cycle control, transcriptional regulation, immune and stress response, cell differentiation, and apoptosis. Interacts with some important proteins involved in transcription factor regulation, cell cycle transition, viral replication and even tumor initiation and progression. Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with AP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response.

Product Categories/Family for PSMB7 recombinant protein

Immunology

References

Proteasome complex as a potential cellular target of hepatitis B virus X protein.Huang J., Kwong J., Sun E.C.-Y., Liang T.J.J. Virol. 70:5582-5591(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 4506189
• NCBI GeneID: 5688
• NCBI Accession #: NP_002783.1
• NCBI GenBank Nucleotide #: NM_002792.3
• UniProt Accession #: O14818; Q5JXJ2; Q9BR53; Q9H4K5; Q9UEU8; B2R515
• Molecular Weight: 50.2 kDa
• NCBI Official Full Name: proteasome subunit alpha type-7
• NCBI Official Synonym Full Names: proteasome subunit alpha 7
• NCBI Official Symbol: PSMA7
• NCBI Official Synonym Symbols: C6; HSPC; RC6-1; XAPC7; HEL-S-276
• NCBI Protein Information: proteasome subunit alpha type-7
• UniProt Protein Name: Proteasome subunit alpha type-7
• Protein Family: Proteasome
• UniProt Gene Name: PSMA7
• UniProt Synonym Gene Names: HSPC
• UniProt Entry Name: PSA7_HUMAN

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012]

Uniprot Description

PSMA7: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Plays an important role in the regulation of cell proliferation or cell cycle control, transcriptional regulation, immune and stress response, cell differentiation, and apoptosis. Interacts with some important proteins involved in transcription factor regulation, cell cycle transition, viral replication and even tumor initiation and progression. Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response. The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. The catalytic chamber with the active sites is on the inside of the barrel. PSMA7 interacts directly with the PSMG1-PSMG2 heterodimer which promotes 20S proteasome assembly. Interacts with HIV-1 TAT protein. Interacts with hepatitis B virus X protein (HBX). Interacts with HIF1A. Interacts with RAB7A. Interacts with PARK2. Interacts with ABL1 and ABL2. Interacts with EMAP2. Interacts with MAVS. Down-regulated by the ribozyme Rz3'X. Up-regulated in colorectal cancer tissues. Belongs to the peptidase T1A family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Proteasome complex; Protease; EC 3.4.25.1

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: cytosol; nucleoplasm; nucleus; proteasome complex; proteasome core complex

Molecular Function: identical protein binding; protein binding; threonine endopeptidase activity

Biological Process: activation of MAPKK activity; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; apoptosis; axon guidance; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; G1/S transition of mitotic cell cycle; gene expression; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; mitotic cell cycle; negative regulation of apoptosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; nerve growth factor receptor signaling pathway; polyamine metabolic process; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; programmed cell death; protein polyubiquitination; Ras protein signal transduction; regulation of amino acid metabolic process; regulation of apoptosis; regulation of mRNA stability; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; small GTPase mediated signal transduction; stimulatory C-type lectin receptor signaling pathway; T cell receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; vascular endothelial growth factor receptor signaling pathway; viral reproduction