Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fibronectin (FN1) Recombinant Protein | FN1 recombinant protein

Recombinant Human Fibronectin (FN1)

Gene Names
FN1; FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibronectin (FN1); Recombinant Human Fibronectin (FN1); Cold-insoluble globulin (CIG); FN1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
732-911aa, Partial of the full length of 723-911AA
Sequence
TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR
Species
Human
Tag
N-terminal 6xHis-tagged
Function
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for FN1 recombinant protein
References
"Phenotypic and genetic alterations in mammary stroma: implications for tumour progression."Schor S.L., Schor A.M.Breast Cancer Res. 3:373-379 (2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
262,625 Da
NCBI Official Full Name
fibronectin isoform 3 preproprotein
NCBI Official Synonym Full Names
fibronectin 1
NCBI Official Symbol
FN1
NCBI Official Synonym Symbols
FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2
NCBI Protein Information
fibronectin; cold-insoluble globulin; migration-stimulating factor
UniProt Protein Name
Fibronectin
Protein Family
UniProt Gene Name
FN1
UniProt Synonym Gene Names
FN; FN; CIG
UniProt Entry Name
FINC_HUMAN

NCBI Description

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

FN1: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Defects in FN1 are the cause of glomerulopathy with fibronectin deposits type 2 (GFND2); also known as familial glomerular nephritis with fibronectin deposits or fibronectin glomerulopathy. GFND is a genetically heterogeneous autosomal dominant disorder characterized clinically by proteinuria, microscopic hematuria, and hypertension that leads to end-stage renal failure in the second to fifth decade of life. 15 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: extracellular matrix; extracellular space; apical plasma membrane; fibrinogen complex; extracellular region; ER-Golgi intermediate compartment; basal lamina

Molecular Function: heparin binding; collagen binding; integrin binding; protein binding; protease activator activity; protease binding

Biological Process: integrin activation; platelet activation; extracellular matrix organization and biogenesis; positive regulation of axon extension; extracellular matrix disassembly; regulation of cell shape; platelet degranulation; acute-phase response; calcium-independent cell-matrix adhesion; cell-substrate junction assembly; response to wounding; peptide cross-linking; angiogenesis; cell adhesion; blood coagulation; leukocyte migration

Disease: Glomerulopathy With Fibronectin Deposits 2; Plasma Fibronectin Deficiency

Research Articles on FN1

Similar Products

Product Notes

The FN1 fn1 (Catalog #AAA7136932) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 732-911aa, Partial of the full length of 723-911AA. The amino acid sequence is listed below: TASSFVVSWV SASDTVSGFR VEYELSEEGD EPQYLDLPST ATSVNIPDLL PGRKYIVNVY QISEDGEQSL ILSTSQTTAP DAPPDPTVDQ VDDTSIVVRW SRPQAPITGY RIVYSPSVEG SSTELNLPET ANSVTLSDLQ PGVQYNITIY AVEENQESTP VVIQQETTGT PRSDTVPSPR. It is sometimes possible for the material contained within the vial of "Fibronectin (FN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.