14-3-3 protein zeta/delta (YWHAZ) Recombinant Protein | YWHAZ recombinant protein

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ), partial

Cat. Num. AAA7135799

• Gene Names: YWHAZ; HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 14-3-3 protein zeta/delta (YWHAZ); Recombinant Human 14-3-3 protein zeta/delta (YWHAZ); partial; Protein kinase C inhibitor protein 1 (KCIP-1); YWHAZ recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 133-212aa; Partial
• Sequence: AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK
• Sequence Length: 245

• Species: Human
• Tag: N-terminal 6xHis-GST-tagged
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. ; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for YWHAZ recombinant protein

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.

Product Categories/Family for YWHAZ recombinant protein

Cell Biology

References

"ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding."
Greninger A.L., Knudsen G.M., Betegon M., Burlingame A.L., DeRisi J.L.MBio 4:E00098-E00098(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 208973238
• NCBI GeneID: 7534
• NCBI Accession #: NP_001129171.1
• NCBI GenBank Nucleotide #: NP_001129171.1
• UniProt Accession #: P63104
• Molecular Weight: 40.6kDa
• NCBI Official Full Name: 14-3-3 protein zeta/delta
• NCBI Official Synonym Full Names: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
• NCBI Official Symbol: YWHAZ
• NCBI Official Synonym Symbols: HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta
• NCBI Protein Information: 14-3-3 protein zeta/delta
• UniProt Protein Name: 14-3-3 protein zeta/delta
• Protein Family: 14-3-3 protein
• UniProt Gene Name: YWHAZ
• UniProt Synonym Gene Names: KCIP-1
• UniProt Entry Name: 1433Z_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

14-3-3 zeta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q23.1

Cellular Component: extracellular space; protein complex; mast cell granule; cytoplasmic vesicle membrane; focal adhesion; mitochondrion; postsynaptic density; leading edge; cytosol; nucleoplasm; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein complex binding; protein kinase binding; transcription factor binding

Biological Process: response to drug; platelet activation; histamine secretion by mast cell; establishment of Golgi localization; apoptosis; gene expression; signal transduction; blood coagulation; protein targeting to mitochondrion; negative regulation of apoptosis