Ephrin Type-A Receptor 3 (EPHA3) Active Protein | EPHA3 active protein

Recombinant Human Ephrin Type-A Receptor 3 (EPHA3), Partial (Active)

Cat. Num. AAA7135707

• Gene Names: EPHA3; EK4; ETK; HEK; ETK1; HEK4; TYRO4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin Type-A Receptor 3 (EPHA3); Recombinant Human Ephrin Type-A Receptor 3 (EPHA3); Partial (Active); EPH-like kinase 4; EK4; hEK4; HEK; Human embryo kinase; Tyrosine-protein kinase TYRO4; Tyrosine-protein kinase receptor ETK1; Eph-like tyrosine kinase 1; ETK; ETK1; TYRO4; EPHA3 active protein

• Host: Mammalian cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
• Sequence Positions: 21-541aa; Partial
• Sequence: ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ
• Sequence Length: 983

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 ug/ml can bind human EFNA5 (MBS964964), the EC50 of the protein is 0.9734-1.179 ng/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Biological Activity

Related Product Information for EPHA3 active protein

Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.

Product Categories/Family for EPHA3 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 21361241
• NCBI GeneID: 2042
• NCBI Accession #: NP_005224.2
• NCBI GenBank Nucleotide #: NP_005224.2
• UniProt Accession #: P29320
• Molecular Weight: 61.0 kDa
• NCBI Official Full Name: ephrin type-A receptor 3 isoform a
• NCBI Official Synonym Full Names: EPH receptor A3
• NCBI Official Symbol: EPHA3
• NCBI Official Synonym Symbols: EK4; ETK; HEK; ETK1; HEK4; TYRO4
• NCBI Protein Information: ephrin type-A receptor 3
• UniProt Protein Name: Ephrin type-A receptor 3
• Protein Family: Ephrin type-A receptor
• UniProt Gene Name: EPHA3
• UniProt Synonym Gene Names: ETK; ETK1; HEK; TYRO4; EK4; hEK4; Human embryo kinase
• UniProt Entry Name: EPHA3_HUMAN

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

EphA3: a receptor tyrosine kinase of the Eph family. Receptor for members of the ephrin-A family: binds to ephrin-A2, -A3, -A4 and -A5The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. Two point mutations seen in a survey of colorectal tumors. Soluble receptors reduce tumor growth and angiogenesis in mouse models. Two alternatively spliced isoforms of EphA3 have been described.

Protein type: Protein kinase, tyrosine (receptor); Kinase, protein; Protein kinase, TK; EC 2.7.10.1; Membrane protein, integral; TK group; Eph family

Chromosomal Location of Human Ortholog: 3p11.2

Cellular Component: integral to plasma membrane; early endosome; plasma membrane; extracellular region

Molecular Function: protein binding; GPI-linked ephrin receptor activity; ATP binding

Biological Process: axon guidance; cell migration; peptidyl-tyrosine phosphorylation; regulation of actin cytoskeleton organization and biogenesis; regulation of focal adhesion formation; ephrin receptor signaling pathway; cell adhesion