Plaque-Size/Host Range (PS/HR) Recombinant Protein | PS/HR recombinant protein
Recombinant Vaccinia Virus Plaque-Size/Host Range Protein (PS/HR), Partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plaque-Size/Host Range (PS/HR); Recombinant Vaccinia Virus Plaque-Size/Host Range Protein (PS/HR); Partial; Protein B5; PS/HR recombinant protein
Host
In Vitro E Coli Expression System
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Tris-Based Buffer, 50% Glycerol
Sequence Positions
17-279aa; Partial
Sequence
VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Sequence Length
317
Species
Vaccinia virus (strain Lister) (VACV)
Tag
N-terminal 6xHis-tagged
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein
Protein Families
Receptors of complement activation (RCA) family
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for PS/HR recombinant protein
Regulation of plaque size and host range.
References
Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins.Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M.Virology 181:158-164(1991).
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
33.2 kDa
NCBI Official Full Name
Plaque-size/host range protein
UniProt Protein Name
Plaque-size/host range protein
Protein Family
UniProt Gene Name
PS/HR
Uniprot Description
Regulation of plaque size and host range.
Similar Products
Product Notes
The PS/HR ps/hr (Catalog #AAA7115358) is a Recombinant Protein produced from In Vitro E Coli Expression System and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-279aa; Partial. The amino acid sequence is listed below: VYSTCTVPTM NNAKLTSTET SFNDKQKVTF TCDQGYHSSD PNAVCETDKW KYENPCKKMC TVSDYVSELY DKPLYEVNST MTLSCNGETK YFRCEEKNGN TSWNDTVTCP NAECQPLQLE HGSCQPVKEK YSFGEYITIN CDVGYEVIGA SYISCTANSW NVIPSCQQKC DMPSLSNGLI SGSTFSIGGV IHLSCKSGFT LTGSPSSTCI DGKWNPILPT CVRSNEKFDP VDDGPDDETD LSKLSKDVVQ YEQEIESLEA TYH. It is sometimes possible for the material contained within the vial of "Plaque-Size/Host Range (PS/HR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
