Activin Receptor Type-2B (ACVR2B) Active Protein | ACVR2B active protein

Recombinant Human Activin Receptor Type-2B (ACVR2B), Partial

Cat. Num. AAA7115167

• Gene Names: ACVR2B; HTX4; ACTRIIB; ActR-IIB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Activin Receptor Type-2B (ACVR2B); Recombinant Human Activin Receptor Type-2B (ACVR2B); Partial; Activin Receptor Type-2B; Activin Receptor Type IIB; ACTR-IIB; ACVR2B; ACVR2B active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 19-134aa; Partial
• Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
• Sequence Length: 512

• Species: Human
• Tag: C-terminal 6xHis-FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human Activin A in functional ELISA is less than 100 ng/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein
• Protein Families: Protein Kinase Superfamily, TKL Ser/Thr protein Kinase Family, TGFB Receptor Subfamily
• Classification: Other Recombinant Protein
• Pathway: TGF-beta Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for ACVR2B active protein

Relevance: Activin proteins that belong to the transforming growth factor-beta (TGF-beta) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Function: Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.

Product Categories/Family for ACVR2B active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 116734708
• NCBI GeneID: 93
• NCBI Accession #: NP_001097.2
• NCBI GenBank Nucleotide #: NM_001106.4
• UniProt Accession #: Q13705
• Molecular Weight: 41.3 kDa
• NCBI Official Full Name: activin receptor type-2B
• NCBI Official Synonym Full Names: activin A receptor type 2B
• NCBI Official Symbol: ACVR2B
• NCBI Official Synonym Symbols: HTX4; ACTRIIB; ActR-IIB
• NCBI Protein Information: activin receptor type-2B
• UniProt Protein Name: Activin receptor type-2B
• Protein Family: Activin receptor
• UniProt Gene Name: ACVR2B
• UniProt Synonym Gene Names: ACTR-IIB
• UniProt Entry Name: AVR2B_HUMAN

NCBI Description

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ACVR2B: a tyrosine-kinase like receptor kinase of the STKR family. The holoreceptor receptor is a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. Each is composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic kinase domain. Type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptor kinases are apparently constitutively active. The IIB receptor displays a 3- to 4-fold higher affinity for activin A than the II receptor.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 3p22

Cellular Component: cytoplasm; integral to plasma membrane; plasma membrane; protein complex; receptor complex

Molecular Function: activin receptor activity, type II; growth factor binding; protein binding; protein serine/threonine kinase activity

Biological Process: activin receptor signaling pathway; anterior/posterior pattern formation; blood vessel remodeling; BMP signaling pathway; lymphangiogenesis; negative regulation of transcription from RNA polymerase II promoter; positive regulation of activin receptor signaling pathway; positive regulation of bone mineralization; positive regulation of osteoblast differentiation; regulation of transcription, DNA-dependent; signal transduction; transmembrane receptor protein serine/threonine kinase signaling pathway

Disease: Heterotaxy, Visceral, 4, Autosomal