Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) Active Protein | TNFSF15 active protein

Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15)

Cat. Num. AAA7115096

• Gene Names: TNFSF15; TL1; TL1A; VEGI; TNLG1B; VEGI192A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15); Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15); Tumor Necrosis Factor Ligand Superfamily Member 15; TNF Ligand-Related Molecule 1; Vascular Endothelial Cell Growth Inhibitor; TNFSF15; TL1; VEGI; TNFSF15 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 250 mM NaCl, pH 7.5
• Sequence Positions: 1-192aa; Full Length of Isoform 2
• Sequence: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Sequence Length: 192

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using HUVEC cells is typically 5 ug/mL.
• Classification: Cytokine
• Subdivision: Tumor Necrosis Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TNFSF15 active protein

Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) is a new member of the tumor necrosis factor family. TNFSF15 is predominantly an endothelial cell-specific gene, and recombinant TNFSF15 is a potent inhibitor of endothelial cell proliferation, angiogenesis and tumor growth. TNFSF15 exerts two activities on endothelial cells: early G1 arrest of G0/G1-cells responding to growth stimuli and programmed cell death of proliferating cells. These activities are highly specific to endothelial cells. TNFSF15 is also able to regulate the expression of several important genes involved in angiogenesis. These findings are consistent with the view that TNFSF15 functions as an autocrine cytokine to inhibit angiogenesis and stabilize the vasculature.

Product Categories/Family for TNFSF15 active protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 324072728
• NCBI GeneID: 9966
• NCBI Accession #: NP_001191273.1
• NCBI GenBank Nucleotide #: NM_001204344.1
• UniProt Accession #: O95150
• Molecular Weight: 21.86 kDa
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 15 isoform VEGI-192
• NCBI Official Synonym Full Names: TNF superfamily member 15
• NCBI Official Symbol: TNFSF15
• NCBI Official Synonym Symbols: TL1; TL1A; VEGI; TNLG1B; VEGI192A
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 15
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 15
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF15
• UniProt Synonym Gene Names: TL1; VEGI
• UniProt Entry Name: TNF15_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

TNFSF15: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Membrane protein, integral; Apoptosis

Chromosomal Location of Human Ortholog: 9q32

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: death receptor binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: caspase activation; cytokine metabolic process; activation of NF-kappaB-inducing kinase; immune response; signal transduction; positive regulation of cytokine secretion