Interleukin-15 Receptor Subunit alpha (IL15RA) Active Protein | IL15RA active protein

Recombinant Human Interleukin-15 Receptor Subunit alpha (IL15RA), Partial

Cat. Num. AAA7115052

• Gene Names: IL15RA; CD215
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-15 Receptor Subunit alpha (IL15RA); Recombinant Human Interleukin-15 Receptor Subunit alpha (IL15RA); Partial; CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179; IL15RA active protein

• Host: Mammalian Cell
• Specificity: Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 31-205aa; Partial
• Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
• Sequence Length: 231

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL-2 mouse cytotoxic T cells is less than 10 ng/ml.
• Subcellular Location: Membrane, Single-Pass Type I Membrane Protein, Nucleus Membrane, Single-Pass Type I Membrane Protein, Note=Mainly found associated with the nuclear Membrane, SUBCELLULAR LOCATION: Isoform 5: Endoplasmic reticulum Membrane, Single-Pass Type I Membrane Protein, Golgi Apparatus Membrane, Single-Pass Type I Membrane Protein, Cytoplasmic vesicle Membrane, Single-Pass Type I Membrane Protein, Membrane, Single-Pass Type I Membrane Protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic Reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear Membrane, SUBCELLULAR LOCATION: Isoform 6: Endoplasmic reticulum Membrane, Single-Pass Type I Membrane Protein, Golgi Apparatus Membrane, Single-Pass Type I Membrane Protein, Cytoplasmic vesicle Membrane, Single-Pass Type I Membrane Protein, Membrane, Single-Pass Type I Membrane Protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic Reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear Membrane, SUBCELLULAR LOCATION: Isoform 7: Endoplasmic reticulum Membrane, Single-Pass Type I Membrane Protein, Golgi Apparatus Membrane, Single-Pass Type I Membrane Protein, Cytoplasmic vesicle Membrane, Single-Pass Type I Membrane Protein, Membrane, Single-Pass Type I Membrane Protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic Reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear Membrane, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum Membrane, Single-Pass Type I Membrane Protein, Golgi Apparatus Membrane, Single-Pass Type I Membrane Protein, Cytoplasmic vesicle Membrane, Single-Pass Type I Membrane Protein, Membrane, Single-Pass Type I Membrane Protein
• Classification: Cytokine
• Subdivision: Interleukin
• Pathway: Jak-STAT Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL15RA active protein

Relevance: Interleukin 15 Receptor alpha (IL-15Ralpha) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15Ralpha chain can bind soluble IL-15 and "transpresent" cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15Ralpha can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15Ralpha complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor beta and gamma heterodimers and enables signaling to cells.

Function: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.

Product Categories/Family for IL15RA active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 343780891
• NCBI GeneID: 3601
• NCBI Accession #: NP_001230468.1
• NCBI GenBank Nucleotide #: NM_001243539.1
• UniProt Accession #: Q13261
• Molecular Weight: 45.5 kDa
• NCBI Official Full Name: interleukin-15 receptor subunit alpha isoform 3
• NCBI Official Synonym Full Names: interleukin 15 receptor subunit alpha
• NCBI Official Symbol: IL15RA
• NCBI Official Synonym Symbols: CD215
• NCBI Protein Information: interleukin-15 receptor subunit alpha
• UniProt Protein Name: Interleukin-15 receptor subunit alpha
• Protein Family: Interleukin-15 receptor
• UniProt Gene Name: IL15RA
• UniProt Synonym Gene Names: IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
• UniProt Entry Name: I15RA_HUMAN

NCBI Description

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.[provided by RefSeq, Apr 2010]

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; nuclear membrane; cytoplasmic vesicle membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity; protein binding

Biological Process: cell proliferation; cytokine and chemokine mediated signaling pathway; signal transduction