Interleukin-36 Receptor Antagonist (IL36RN) Active Protein | IL36RN active protein

Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN)

Cat. Num. AAA7115038

• Gene Names: IL36RN; FIL1; FIL1D; IL1F5; IL1L1; PSORP; IL1HY1; IL1RP3; IL36RA; IL-36Ra; PSORS14; FIL1(DELTA)
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-36 Receptor Antagonist (IL36RN); Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN); Interleukin-36 Receptor Antagonist Protein; FIL1 Delta; IL-1-Related Protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1; Interleukin-1 Delta; IL-1 Delta; Interleukin-1 Family Member 5; IL-1F5; Interleukin-1 Receptor Antagonist Homolog 1; IL-1ra Homolog 1; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RN active protein

• Host: E Coli
• Specificity: Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
• Sequence Positions: 1-155aa; Full Length
• Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
• Sequence Length: 155

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to inhibit IL-36 alpha, IL-36 beta or IL-36 gamma -induced IL-8 secretion in A431 human epithelial carcinoma cells is less than 500 ng/ml in the presence of 10 ng/mL of recombinant human IL-36 beta.
• Subcellular Location: Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL36RN active protein

Relevance: Human Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.

Function: Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.

Product Categories/Family for IL36RN active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 6912432
• NCBI GeneID: 26525
• NCBI Accession #: NP_036407.1
• NCBI GenBank Nucleotide #: NM_012275.2
• UniProt Accession #: Q9UBH0
• Molecular Weight: 16.9 kDa
• NCBI Official Full Name: interleukin-36 receptor antagonist protein
• NCBI Official Synonym Full Names: interleukin 36 receptor antagonist
• NCBI Official Symbol: IL36RN
• NCBI Official Synonym Symbols: FIL1; FIL1D; IL1F5; IL1L1; PSORP; IL1HY1; IL1RP3; IL36RA; IL-36Ra; PSORS14; FIL1(DELTA)
• NCBI Protein Information: interleukin-36 receptor antagonist protein
• UniProt Protein Name: Interleukin-36 receptor antagonist protein
• Protein Family: Interleukin-36 receptor antagonist protein
• UniProt Gene Name: IL36RN
• UniProt Synonym Gene Names: FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3; IL-1RP3; IL-1HY1; IL-1 delta; IL-1F5; IL-1ra homolog 1; IL-1L1
• UniProt Entry Name: I36RA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1F5: Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL- 1R1), that is present in epithelial barriers and takes part in local inflammatory response. Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP). PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein. Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: extracellular space

Molecular Function: cytokine activity; interleukin-1 receptor binding; protein binding

Biological Process: antifungal humoral response; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of interleukin-17 production

Disease: Psoriasis 14, Pustular