Fibroblast Growth Factor 1 (FGF1) Active Protein | FGF1 active protein

Recombinant Human Fibroblast Growth Factor 1 (FGF1)

Cat. Num. AAA7114973

• Gene Names: FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor 1 (FGF1); Recombinant Human Fibroblast Growth Factor 1 (FGF1); Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA; FGF1 active protein

• Host: E Coli
• Specificity: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0
• Sequence Positions: 16-155aa; Full Length of Mature Protein
• Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Sequence Length: 154

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
• Subcellular Location: Secreted, Cytoplasm, Cytoplasm, Cell Cortex, Cytoplasm, Cytosol, Nucleus
• Protein Families: Heparin-Binding Growth Factors Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Pathway: Hippo Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for FGF1 active protein

Relevance: FGF acidic, also known as ECGF, FGF-1and HBGF-1, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. It is a mitogenic peptide that is produced by multiple cell types and stimulates the proliferation of cells of mesodermal, ectodermal, and endodermal origin. Its association with heparan sulfate is a prerequisite for activation of FGF receptors. Internalized FGF acidic migrates to the nucleus where it is phosphorylated by nuclear PKC delta, exported to the cytosol, dephosphorylated, and degraded. Intracellular FGF acidic inhibits p53 activity and proapoptotic signaling.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV.

Product Categories/Family for FGF1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 13236891
• NCBI GeneID: 2246
• UniProt Accession #: P05230
• Molecular Weight: 15.9 kDa
• NCBI Official Full Name: acidic fibroblast growth factor, partial
• NCBI Official Synonym Full Names: fibroblast growth factor 1
• NCBI Official Symbol: FGF1
• NCBI Official Synonym Symbols: AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• NCBI Protein Information: fibroblast growth factor 1
• UniProt Protein Name: Fibroblast growth factor 1
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF1
• UniProt Synonym Gene Names: FGFA; FGF-1; aFGF; ECGF; HBGF-1
• UniProt Entry Name: FGF1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; extracellular space; proteinaceous extracellular matrix; extracellular region; nucleolus; cell cortex; cytosol

Molecular Function: heparin binding; protein binding; growth factor activity; Hsp70 protein binding; fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; anatomical structure morphogenesis; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; multicellular organismal development; positive regulation of cholesterol biosynthetic process; signal transduction; positive regulation of MAP kinase activity; positive regulation of angiogenesis; induction of an organ; positive regulation of cell division; positive regulation of cell proliferation; insulin receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; positive regulation of epithelial cell proliferation; lung development; positive regulation of cell migration