Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

2'-5'-oligoadenylate synthase 1B (Oas1b) Recombinant Protein | Oas1b recombinant protein

Recombinant Mouse 2'-5'-oligoadenylate synthase 1B (Oas1b), partial

Gene Names
Oas1b; L1; Flv; Wnv; Oas1; Oias2; Mmu-L1; Oias-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
2'-5'-oligoadenylate synthase 1B (Oas1b); Recombinant Mouse 2'-5'-oligoadenylate synthase 1B (Oas1b); partial; Oas1b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351aa; Partial
Sequence
MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVKGKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSLRSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEGKLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYGSRVTKFNTAQGFRTVLELVTKYKQLQIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPADPTRNIAGLNPKDWRRLAGEAAAWLQYPCFKYRDGSSVCSWEVPTEVGVPMK
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,620 Da
NCBI Official Full Name
inactive 2'-5'-oligoadenylate synthase 1B
NCBI Official Synonym Full Names
2'-5' oligoadenylate synthetase 1B
NCBI Official Symbol
Oas1b
NCBI Official Synonym Symbols
L1; Flv; Wnv; Oas1; Oias2; Mmu-L1; Oias-2
NCBI Protein Information
inactive 2'-5'-oligoadenylate synthase 1B
UniProt Protein Name
Inactive 2'-5'-oligoadenylate synthase 1B
UniProt Gene Name
Oas1b
UniProt Synonym Gene Names
Flv; Oias2; (2-5')oligo(A) synthase 1B; 2-5A synthase 1B

NCBI Description

This gene is a member of the 2'-5' oligoA synthetase family, which are clustered on chromosome 5. The encoded protein functions in the interferon-regulated OAS/RNase L system, which mediates RNA decay as part of the innate antiviral immunity pathway. The protein binds double-stranded RNA and oligomerizes ATP, which activate the single-stranded RNA cleavage enzyme RNase L. This protein mediates resistance to flaviviruses such as West Nile virus. The majority of wild mouse strains produce a functional protein and are resistant to flavivirus infection, whereas some inbred mouse strains including the strain of the reference genome, C57BL/6J, contain a premature stop codon that inactivates this gene product. [provided by RefSeq, Jul 2008]

Uniprot Description

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA (PubMed:12396720, PubMed:27663720). The full-length protein displays antiviral activity against flaviviruses such as west Nile virus (WNV) via an alternative antiviral pathway independent of RNase L (PubMed:16371364, PubMed:27663720). The truncated form of the protein lacks antiviral activity (PubMed:16371364).

Research Articles on Oas1b

Similar Products

Product Notes

The Oas1b oas1b (Catalog #AAA7086929) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351aa; Partial. The amino acid sequence is listed below: MEQDLRSIPA SKLDKFIENH LPDTSFCADL REVIDALCAL LKDRSFRGPV RRMRASKGVK GKGTTLKGRS DADLVVFLNN LTSFEDQLNQ QGVLIKEIKK QLCEVQHERR CGVKFEVHSL RSPNSRALSF KLSAPDLLKE VKFDVLPAYD LLDHLNILKK PNQQFYANLI SGRTPPGKEG KLSICFMGLR KYFLNCRPTK LKRLIRLVTH WYQLCKEKLG DPLPPQYALE LLTVYAWEYG SRVTKFNTAQ GFRTVLELVT KYKQLQIYWT VYYDFRHQEV SEYLHQQLKK DRPVILDPAD PTRNIAGLNP KDWRRLAGEA AAWLQYPCFK YRDGSSVCSW EVPTEVGVPM K . It is sometimes possible for the material contained within the vial of "2'-5'-oligoadenylate synthase 1B (Oas1b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.