Adenylyltransferase and sulfurtransferase uba4 Recombinant Protein | ATEG_07600 recombinant protein
Recombinant Aspergillus terreus Adenylyltransferase and sulfurtransferase uba4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenylyltransferase and sulfurtransferase uba4; Recombinant Aspergillus terreus Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; Including the following 2 domains; Mol; ATEG_07600 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-484aa; full length protein
Sequence
MDDLESTCASLRAQISATETQLAGLKRALHEAEQAAAHAKAQSAAATTAGDNHDKPRRWP LLDEEYRRYGRQMIVPQLGLPGQLKLRSARVLIVGAGGLGCPAALYLAGAGVGTLGLIDG DMVDVSNLHRQVLHRSANVGKLKVDSAIEYLRELNPHPTYIPHRAHLTPQEAPEIFQNYD VILDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPRPAGDKTGGPCYRCV FPKPPPANSILSCADGGILGPVVGTMGVLQALEAIKVITSTEDEVRPPSLHIFSAYSSPP FRSIKLRSRRANCAVCSAERQVTLDTLRSGLTDYVFFCGSVSPEAVLTAEERIAPREYRA MYPAPTEGAPEKTPTLIDVREKVQYDICNLAESINIPISTIQASAAGSGDETGSSLPAWL PPEIASTDSTDPIYVVCRMGNDSQLAVRRLKELGLDRGGARVVADIQGGFRAWREQVDPE WPEY
Sequence Length
484
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,219 Da
NCBI Official Full Name
hypothetical protein ATEG_07600
NCBI Official Symbol
ATEG_07600
NCBI Protein Information
similar to molybdopterin biosynthesis protein MoeB
UniProt Protein Name
Adenylyltransferase and sulfurtransferase uba4
Protein Family
UniProt Gene Name
uba4
Uniprot Description
Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions ().
Similar Products
Product Notes
The ATEG_07600 uba4 (Catalog #AAA7072012) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-484aa; full length protein. The amino acid sequence is listed below: MDDLESTCAS LRAQISATET QLAGLKRALH EAEQAAAHAK AQSAAATTAG DNHDKPRRWP LLDEEYRRYG RQMIVPQLGL PGQLKLRSAR VLIVGAGGLG CPAALYLAGA GVGTLGLIDG DMVDVSNLHR QVLHRSANVG KLKVDSAIEY LRELNPHPTY IPHRAHLTPQ EAPEIFQNYD VILDCTDNPA TRYLISDTAV LLGKPLVSAS ALRTEGQLMV LNNPPRPAGD KTGGPCYRCV FPKPPPANSI LSCADGGILG PVVGTMGVLQ ALEAIKVITS TEDEVRPPSL HIFSAYSSPP FRSIKLRSRR ANCAVCSAER QVTLDTLRSG LTDYVFFCGS VSPEAVLTAE ERIAPREYRA MYPAPTEGAP EKTPTLIDVR EKVQYDICNL AESINIPIST IQASAAGSGD ETGSSLPAWL PPEIASTDST DPIYVVCRMG NDSQLAVRRL KELGLDRGGA RVVADIQGGF RAWREQVDPE WPEY. It is sometimes possible for the material contained within the vial of "Adenylyltransferase and sulfurtransferase uba4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
