Sigma-E factor negative regulatory protein (rseA) Recombinant Protein | rseA recombinant protein

Recombinant Escherichia coli Sigma-E factor negative regulatory protein (rseA) , partial

Cat. Num. AAA7062519

• Gene Names: rseA; ECK2570; JW2556; mclA; yfiJ
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sigma-E factor negative regulatory protein (rseA); Recombinant Escherichia coli Sigma-E factor negative regulatory protein (rseA); partial; rseA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-100aa; Partial
• Sequence: MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQ

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16130497
• NCBI GeneID: 947053
• NCBI Accession #: NP_417067.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AFX7; P38106; Q2MAF8
• Molecular Weight: 24,321 Da
• NCBI Official Full Name: anti-sigma factor
• NCBI Official Symbol: rseA
• NCBI Official Synonym Symbols: ECK2570; JW2556; mclA; yfiJ
• NCBI Protein Information: anti-sigma factor
• UniProt Protein Name: Anti-sigma-E factor RseA
• Protein Family: Anti-sigma-E factor
• UniProt Gene Name: rseA
• UniProt Synonym Gene Names: mclA; yfiJ

NCBI Description

The anti-sigma N-terminal RseA domain is linked to the periplasmic domain by a single membrane domain spanning residues 100-118. [More information is available at EcoGene: EG12341]. RseA is an anti-sigma factor that inhibits sigma E . [More information is available at EcoCyc: EG12341].

Uniprot Description

An anti-sigma factor for extracytoplasmic function (ECF) sigma factor sigma-E (RpoE). ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut periplasmically (site-1 protease, S1P, DegS), then within the membrane itself (site-2 protease, S2P, RseP), while cytoplasmic proteases finish degrading the anti-sigma factor, liberating sigma-E. Overexpression of RseA blocks sigma-E from acting, results in cell lysis in stationary phase and temperature-sensitivity above 37 degrees Celsius.