SDS-PAGE
Plasmodium Uncharacterized protein (berghei PBANKA_093100) Recombinant Protein
Recombinant Plasmodium Uncharacterized protein (berghei PBANKA_093100), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plasmodium Uncharacterized protein (berghei PBANKA_093100); Recombinant Plasmodium Uncharacterized protein (berghei PBANKA_093100); partial; Plasmodium Uncharacterized protein (berghei PBANKA_093100) recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
756-960aa; Partial
Sequence
QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR
Species
Plasmodium berghei (strain Anka)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for Plasmodium Uncharacterized protein (berghei PBANKA_093100) recombinant protein
References
"A comprehensive evaluation of rodent malaria parasite genomes and gene expression." Otto T.D., Bohme U., Jackson A.P., Hunt M., Franke-Fayard B., Hoeijmakers W.A., Religa A.A., Robertson L., Sanders M., Ogun S.A., Cunningham D., Erhart A., Billker O., Khan S.M., Stunnenberg H.G., Langhorne J., Holder A.A., Waters A.P. Janse C.J. BMC Biol. 12:86-86(2014)
Similar Products
Product Notes
The Plasmodium Uncharacterized protein (berghei PBANKA_093100) (Catalog #AAA7053546) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 756-960aa; Partial. The amino acid sequence is listed below: QNIKTIFSSF TFYFFFFIFI YAFLLSIMHI FINYFFYIYL FVFNINIYIS NIYTIIMTFA SLIAIPFSGY IIDNIGSFLF LLLCSSFFIL IAISGTIYSC VFNLRSEVIA FISFNLIGIS ESIIPTVIIS QIPTHLCVKK NEDITAAFAI FELVSMLIVS VNNYIFGYFL INKEYLNGLY ILFVFVILVI SLIFLLIFTI YWKAR. It is sometimes possible for the material contained within the vial of "Plasmodium Uncharacterized protein (berghei PBANKA_093100), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
