Tumor necrosis factor ligand superfamily member 14 Recombinant Protein | TNFSF14 recombinant protein

Tumor necrosis factor ligand superfamily member 14

Cat. Num. AAA7043499

• Gene Names: TNFSF14; LTg; CD258; HVEML; LIGHT
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor ligand superfamily member 14; TNFSF14 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-240aa; full length protein
• Sequence: MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
• Sequence Length: Full Length Protein

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TNFSF14 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for TNFSF14 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 25952144
• NCBI GeneID: 8740
• NCBI Accession #: NP_003798.2
• NCBI GenBank Nucleotide #: NM_003807.4
• UniProt Accession #: O43557; O75476; Q6FHA1; Q8WVF8; Q96LD2; A8K7M2; C9J5H4
• Molecular Weight: 22,395 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 14 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor superfamily member 14
• NCBI Official Symbol: TNFSF14
• NCBI Official Synonym Symbols: LTg; CD258; HVEML; LIGHT
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 14
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 14
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF14
• UniProt Synonym Gene Names: HVEML; LIGHT; HVEM-L; Herpesvirus entry mediator ligand
• UniProt Entry Name: TNF14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF14: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. Acts as a receptor for Herpes simplex virus. Belongs to the tumor necrosis factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Membrane protein, integral; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: plasma membrane

Molecular Function: caspase inhibitor activity; protein binding; receptor binding

Biological Process: apoptosis; release of cytoplasmic sequestered NF-kappaB; tumor necrosis factor-mediated signaling pathway