Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protransforming growth factor alphaCleaved into the following chain: Recombinant Protein | TGFA recombinant protein

Protransforming growth factor alphaCleaved into the following chain:

Gene Names
TGFA; TFGA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protransforming growth factor alphaCleaved into the following chain:; TGFA recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-160aa; full length protein
Sequence
ENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TGFA recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for TGFA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,329 Da
NCBI Official Full Name
protransforming growth factor alpha isoform 2 preproprotein
NCBI Official Synonym Full Names
transforming growth factor alpha
NCBI Official Symbol
TGFA
NCBI Official Synonym Symbols
TFGA
NCBI Protein Information
protransforming growth factor alpha
UniProt Protein Name
Protransforming growth factor alpha
UniProt Gene Name
TGFA
UniProt Synonym Gene Names
TGF-alpha; ETGF
UniProt Entry Name
TGFA_HUMAN

NCBI Description

This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

TGFalpha: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. Interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP, is required for the targeting to the cell surface. In the endoplasmic reticulum, in its immature form (i.e. with a prosegment and lacking full N-glycosylation), interacts with CNIH. In the Golgi apparatus, may form a complex with CNIH and GORASP2. Interacts (via cytoplasmic C-terminal domain) with NKD2. Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligand, receptor tyrosine kinase; Cell cycle regulation; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: basolateral plasma membrane; cell surface; cytoplasmic vesicle; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; extracellular space; integral to plasma membrane; perinuclear region of cytoplasm

Molecular Function: epidermal growth factor receptor binding; growth factor activity; protein binding

Biological Process: activation of MAPK activity; cell proliferation; COPII coating of Golgi vesicle; ER to Golgi vesicle-mediated transport; positive regulation of epidermal growth factor receptor activity; positive regulation of epithelial cell proliferation; positive regulation of mitosis

Research Articles on TGFA

Similar Products

Product Notes

The TGFA tgfa (Catalog #AAA7043428) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-160aa; full length protein. The amino acid sequence is listed below: ENSTSPLSAD PPVAAAVVSH FNDCPDSHTQ FCFHGTCRFL VQEDKPACVC HSGYVGARCE HADLLAVVAA SQKKQAITAL VVVSIVALAV LIITCVLIHC CQVRKHCEWC RALICRHEKP SALLKGRTAC CHSETVV. It is sometimes possible for the material contained within the vial of "Protransforming growth factor alphaCleaved into the following chain:, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.