Mitochondrial cardiolipin hydrolase Recombinant Protein | CHLREDRAFT_190403 recombinant protein
Mitochondrial cardiolipin hydrolase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial cardiolipin hydrolase; CHLREDRAFT_190403 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-223aa; full length protein
Sequence
MGCASSKEEVALTPLSDVNAAKEVADLKAQVDQLKRQLASAGQSAAPAAAGAVKGGVVETLFFPDEKLPCRNNRRPGGCKRQHCEYSHTPTSLSRFLDYLGSATRTLDICVFTITNDDISDVVLELHNKGVRVRIISDNDQAHTQGSDIDKFRQAGIAVRQDKTAAHMHHKFAIIDGRLLLNGSFNWTRQAVTANNENVTVLSDPKLIASFQQQFDKLWDMFK
Sequence Length
Full Length Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CHLREDRAFT_190403 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CHLREDRAFT_190403 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,524 Da
NCBI Official Full Name
predicted protein
NCBI Official Symbol
CHLREDRAFT_190403
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Mitochondrial cardiolipin hydrolase
Protein Family
UniProt Gene Name
CHLREDRAFT_190403
UniProt Synonym Gene Names
PLD 6
UniProt Entry Name
PLD6_CHLRE
Uniprot Description
Plays a critical role in PIWI-interacting RNA (piRNA) biogenesis (). piRNAs provide essential protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus critical for maintaining genome stability. Backbone-non-specific, single strand-specific nuclease, cleaving either RNA or DNA substrates with similar affinity (). Produces 5' phosphate and 3' hydroxyl termini, suggesting it could directly participate in the processing of primary piRNA transcripts (). Has been proposed to act as a cardiolipin hydrolase to generate phosphatidic acid at mitochondrial surface. Although it cannot be excluded that it can act as a phospholipase in some circumstances, this activity could not be confirmed ().
Similar Products
Product Notes
The CHLREDRAFT_190403 chlredraft_190403 (Catalog #AAA7043201) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-223aa; full length protein. The amino acid sequence is listed below: MGCASSKEEV ALTPLSDVNA AKEVADLKAQ VDQLKRQLAS AGQSAAPAAA GAVKGGVVET LFFPDEKLPC RNNRRPGGCK RQHCEYSHTP TSLSRFLDYL GSATRTLDIC VFTITNDDIS DVVLELHNKG VRVRIISDND QAHTQGSDID KFRQAGIAVR QDKTAAHMHH KFAIIDGRLL LNGSFNWTRQ AVTANNENVT VLSDPKLIAS FQQQFDKLWD MFK. It is sometimes possible for the material contained within the vial of "Mitochondrial cardiolipin hydrolase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
