N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Recombinant Protein | Gcnt2 recombinant protein
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
Gene Names
Gcnt2; IGnT; IGnTA; IGnTB; IGnTC; 5330430K10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
N-acetyllactosaminide beta-1; 6-N-acetylglucosaminyl-transferase; Gcnt2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-401aa; full length protein
Sequence
MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Gcnt2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Gcnt2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,697 Da
NCBI Official Full Name
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform A
NCBI Official Synonym Full Names
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
NCBI Official Symbol
Gcnt2
NCBI Official Synonym Symbols
IGnT; IGnTA; IGnTB; IGnTC; 5330430K10Rik
NCBI Protein Information
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
UniProt Protein Name
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
UniProt Gene Name
Gcnt2
UniProt Synonym Gene Names
N-acetylglucosaminyltransferase
UniProt Entry Name
GCNT2_MOUSE
Uniprot Description
GCNT2 iso2: Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. The expression of the blood group I antigen in erythrocytes is determined by isoform C. Belongs to the glycosyltransferase 14 family. 3 isoforms of the human protein are produced by alternative splicing
Protein type: EC 2.4.1.150; Membrane protein, integral
Molecular Function: acetylglucosaminyltransferase activity; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity
Biological Process: positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of heterotypic cell-cell adhesion; positive regulation of protein kinase B signaling cascade; protein amino acid glycosylation; transforming growth factor beta receptor signaling pathway
Research Articles on Gcnt2
Similar Products
Product Notes
The Gcnt2 gcnt2 (Catalog #AAA7042786) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-401aa; full length protein. The amino acid sequence is listed below: MPPSVRYFFI VSVTTVIVFI VLYVLSFGGD QSYQKLNISD SVMLAQVCSS FIDGKSRFLW RNKLMIHEKP SCTEYVTQSH YITAPLSQEE VDFPLAYVMV IHHNFDTFAR LFRAIFMPQN IYCVHVDEKA TAEFKGAVEQ LVSCFPNAFL ASKMEPVVYG GISRLQADLN CIKDLSTSEV PWKYAINTCG QDFPLKTNKE IVQYLKGLKG KNLTPGVLPP AHAIGRTRYV HREHLSKELS YVIRTTALKP PPPHNLTIYF GSAYVALSRE FANFVLRDPR AVDLLHWSKD TFSPDEHFWV TLNRIPGVPG SMPPNASWTG NLRAVKWMDM EAKHGGCHGH YVHGICIYGN GDLQWLINSQ SLFANKFELN TYPLTVECLE LRLRERTLNQ SEIAIQPSWY F. It is sometimes possible for the material contained within the vial of "N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
