Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FXYD domain-containing ion transport regulator 5 Recombinant Protein | Fxyd5 recombinant protein

FXYD domain-containing ion transport regulator 5

Gene Names
Fxyd5; RIC; EF-8; Oit2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FXYD domain-containing ion transport regulator 5; Fxyd5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-178aa; full length protein
Sequence
QTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Fxyd5 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Fxyd5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,454 Da
NCBI Official Full Name
FXYD domain-containing ion transport regulator 5 isoform a
NCBI Official Synonym Full Names
FXYD domain-containing ion transport regulator 5
NCBI Official Symbol
Fxyd5
NCBI Official Synonym Symbols
RIC; EF-8; Oit2
NCBI Protein Information
FXYD domain-containing ion transport regulator 5
UniProt Protein Name
FXYD domain-containing ion transport regulator 5
UniProt Gene Name
Fxyd5
UniProt Synonym Gene Names
Oit2
UniProt Entry Name
FXYD5_MOUSE

NCBI Description

This gene encodes a precursor protein that is member of the FXYD family of transmembrane glycoproteins. Like most members of the FXYD family, the encoded protein is a subunit of the sodium-potassium adenosine triphosphatase pump. FXYD family members have tissue-specific expression and differentially regulate the activity of this pump. The protein encoded by this gene also plays a role in cell adhesion and motility. The orthologous human protein inhibits epithelial cadherin, a calcium-dependent adhesion protein and is associated with cancer (promotes metastasis). Alternative splicing of this mouse gene results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

FXYD5: Involved in down-regulation of E-cadherin which results in reduced cell adhesion. Promotes metastasis. Belongs to the FXYD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Actin-binding; Cell adhesion

Cellular Component: integral to membrane; integral to plasma membrane

Molecular Function: actin binding; cadherin binding; sodium channel regulator activity

Research Articles on Fxyd5

Similar Products

Product Notes

The Fxyd5 fxyd5 (Catalog #AAA7042777) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-178aa; full length protein. The amino acid sequence is listed below: QTPKKPTSIF TADQTSATTR DNVPDPDQTS PGVQTTPLIW TREEATGSQT AAQTETQQLT KMATSNPVSD PGPHTSSKKG TPAVSRIEPL SPSKNFMPPS YIEHPLDSNE NNPFYYDDTT LRKRGLLVAA VLFITGIIIL TSGKCRQLSQ FCLNRHR. It is sometimes possible for the material contained within the vial of "FXYD domain-containing ion transport regulator 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.