Dolichol-phosphate mannosyltransferase Recombinant Protein | DPM1 recombinant protein
Dolichol-phosphate mannosyltransferase
Gene Names
DPM1; SED3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichol-phosphate mannosyltransferase; DPM1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-267aa; full length protein
Sequence
SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF
Sequence Length
Full Length Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for DPM1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for DPM1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,362 Da
NCBI Official Full Name
dolichyl-phosphate beta-D-mannosyltransferase
NCBI Official Symbol
DPM1
NCBI Official Synonym Symbols
SED3
NCBI Protein Information
dolichyl-phosphate beta-D-mannosyltransferase
UniProt Protein Name
Dolichol-phosphate mannosyltransferase
Protein Family
UniProt Gene Name
DPM1
UniProt Synonym Gene Names
SED3; DPM synthase; MPD synthase
UniProt Entry Name
DPM1_YEAST
Uniprot Description
Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
Research Articles on DPM1
Similar Products
Product Notes
The DPM1 dpm1 (Catalog #AAA7042627) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-267aa; full length protein. The amino acid sequence is listed below: SIEYSVIVPA YHEKLNIKPL TTRLFAGMSP EMAKKTELIF VDDNSQDGSV EEVDALAHQG YNVRIIVRTN ERGLSSAVLK GFYEAKGQYL VCMDADLQHP PETVPKLFES LHDHAFTLGT RYAPGVGIDK DWPMYRRVIS STARMMARPL TIASDPMSGF FGLQKKYLEN CNPRDINSQG FKIALELLAK LPLPRDPRVA IGEVPFTFGV RTEGESKLSG KVIIQYLQQL KELYVFKFGA NNLILFITFW SILFFYVCYQ LYHLVF. It is sometimes possible for the material contained within the vial of "Dolichol-phosphate mannosyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
