Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Structural polyprotein Recombinant Protein | C recombinant protein

Recombinant Venezuelan equine encephalitis virus Structural polyprotein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Structural polyprotein; Recombinant Venezuelan equine encephalitis virus Structural polyprotein; C recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
813-1254aa; full length protein
Sequence
YEHATTMPNQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPTI KCCGSQECTPTYRPDEQCKVFAGVYPFMWGGAYCFCDTENTQISKAYVMKSEDCLADHAA AYKAHTASVQALLNITVGEHSTVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQLRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEASVELAEQGSVTIHFSTAN IHPEFRLQICTSFVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATLVAMYVLTNQKHN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Venezuelan equine encephalitis virus (strain Everglades Fe3-7c) (VEEV)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
138,338 Da
NCBI Official Full Name
Structural polyprotein
UniProt Protein Name
Structural polyprotein
Protein Family
UniProt Gene Name
C
UniProt Synonym Gene Names
C
UniProt Entry Name
POLS_EEVVE

Uniprot Description

Capsid protein possesses a protease activity that results in its autocatalytic cleavage from the nascent structural protein. Following its self-cleavage, the capsid protein transiently associates with ribosomes, and within several minutes the protein binds to viral RNA and rapidly assembles into icosaedric core particles. The resulting nucleocapsid eventually associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and formation of mature virions. New virions attach to target cells, and after clathrin-mediated endocytosis their membrane fuses with the host endosomal membrane. This leads to the release of the nucleocapsid into the cytoplasm, followed by an uncoating event necessary for the genomic RNA to become accessible. The uncoating might be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes would release the genomic RNA since the same region is genomic RNA-binding and ribosome-binding ().

Similar Products

Product Notes

The Structural polyprotein c (Catalog #AAA7041322) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 813-1254aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Structural polyprotein c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YEHATTMPNQ AGISYNTIVN RAGYAPLPIS ITPTKIKLIP TVNLEYVTCH YKTGMDSPTI KCCGSQECTP TYRPDEQCKV FAGVYPFMWG GAYCFCDTEN TQISKAYVMK SEDCLADHAA AYKAHTASVQ ALLNITVGEH STVTTVYVNG ETPVNFNGVK LTAGPLSTAW TPFDRKIVQY AGEIYNYDFP EYGAGQPGAF GDIQLRTVSS SDLYANTNLV LQRPKAGAIH VPYTQAPSGF EQWKKDKAPS LKFTAPFGCE IYTNPIRAEN CAVGSIPLAF DIPDALFTRV SETPTLSAAE CTLNECVYSS DFGGIATVKY SASKSGKCAV HVPSGTATLK EASVELAEQG SVTIHFSTAN IHPEFRLQIC TSFVTCKGDC HPPKDHIVTH PQYHAQTFTA AVSKTAWTWL TSLLGGSAVI IIIGLVLATL VAMYVLTNQK HN. It is sometimes possible for the material contained within the vial of "Structural polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.