UPF0603 protein Rv2345/MT2410 Recombinant Protein | Rv2345 recombinant protein
Recombinant UPF0603 protein Rv2345/MT2410 (Rv2345, MT2410)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0603 protein Rv2345/MT2410; Recombinant UPF0603 protein Rv2345/MT2410 (Rv2345; MT2410); Rv2345 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-660aa; full length protein
Sequence
QPPFRLSNYVTDNAGVLTSSGRTAVTAAVDRLYADRRIRLWVVYVENFSGQSALNWAQRT TRTSELGNYDALLAVATTGREYAFLVPSAMPGVSEGQVDNVRRYQIEPALHDGDYSGAAV AAANGLNRSPSSSSRVVLLVTVGIIVIVVAVLLVVMRHRNRRRRADELAAARRVDPTNVM ALAAVPLQALDDLSRSMVVDVDNAVRTSTNELALAIEEFGERRTAPFTQAVNNAKAALSQ AFTVRQQLDDNTPETPAQRRELLTRVIVSAAHADRELASQTEAFEKLRDLVINAPARLDL LTQQYVELTTRIGPTQQRLAELHTEFDAAAMTSIAGNVTTATERLAFADRNISAARDLAD QAVSGRQAGLVDAVRAAESALGQARALLDAVDSAATDIRHAVASLPAVVADIQTGIKRAN QHLQQAQQPQTGRTGDLIAARDAAARALDRARGAADPLTAFDQLTKVDADLDRLLATLAE EQATADRLNRSLEQALFTAESRVRAVSEYIDTRRGSIGPEARTRLAEAKRQLEAAHDRKS SNPTEAIAYANAASTLAAHAQSLANADVQSAQRAYTRRGGNNAGAILGGIIIGDLLSGGT RGGLGGWIPTSFGGSSNAPGSSPDGGFLGGGGRF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mycobacterium tuberculosis
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rv2345 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Symbol
Rv2345
NCBI Protein Information
transmembrane protein
Protein Family
Research Articles on Rv2345
Similar Products
Product Notes
The Rv2345 (Catalog #AAA7041193) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-660aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rv2345 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPPFRLSNYV TDNAGVLTSS GRTAVTAAVD RLYADRRIRL WVVYVENFSG QSALNWAQRT TRTSELGNYD ALLAVATTGR EYAFLVPSAM PGVSEGQVDN VRRYQIEPAL HDGDYSGAAV AAANGLNRSP SSSSRVVLLV TVGIIVIVVA VLLVVMRHRN RRRRADELAA ARRVDPTNVM ALAAVPLQAL DDLSRSMVVD VDNAVRTSTN ELALAIEEFG ERRTAPFTQA VNNAKAALSQ AFTVRQQLDD NTPETPAQRR ELLTRVIVSA AHADRELASQ TEAFEKLRDL VINAPARLDL LTQQYVELTT RIGPTQQRLA ELHTEFDAAA MTSIAGNVTT ATERLAFADR NISAARDLAD QAVSGRQAGL VDAVRAAESA LGQARALLDA VDSAATDIRH AVASLPAVVA DIQTGIKRAN QHLQQAQQPQ TGRTGDLIAA RDAAARALDR ARGAADPLTA FDQLTKVDAD LDRLLATLAE EQATADRLNR SLEQALFTAE SRVRAVSEYI DTRRGSIGPE ARTRLAEAKR QLEAAHDRKS SNPTEAIAYA NAASTLAAHA QSLANADVQS AQRAYTRRGG NNAGAILGGI IIGDLLSGGT RGGLGGWIPT SFGGSSNAPG SSPDGGFLGG GGRF. It is sometimes possible for the material contained within the vial of "UPF0603 protein Rv2345/MT2410, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
