Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-dependent zinc metalloprotease YME1 homolog Recombinant Protein | SPCC965.04c recombinant protein

Recombinant Schizosaccharomyces pombe ATP-dependent zinc metalloprotease YME1 homolog (SPCC965.04c)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease YME1 homolog; Recombinant Schizosaccharomyces pombe ATP-dependent zinc metalloprotease YME1 homolog (SPCC965.04c); SPCC965.04c recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-709aa; full length protein
Sequence
MSRVLHPIFLFGKTSFLYSGCSKFGGRLFNNSIVHGWLRTRSYALASGLHPLRKQKLAHF EDLANANMSDPYMQAKLYKELADNFPEAIISRYETQGVARNSACDRYYQEALRKKSWSRS LSNNISLSQSSSSPATSSFSDPKAFSAGVPKFTSDTSSTVSSTPSLNHSLQNSMPPSTPT PPPVWAPTIVSSALGTSSKTPVYVVVDEPRFTKFFRIFKFIAGLSVASYFVLLGMSIFAE TSGLNNIMTNTTEQEPMEERAINVRFSDVQGVDEAKEELEEIVDFLRDPTHFTRLGGKLP RGVLLTGPPGTGKTMLARAVAGEANVPFFFMSGSQFDEMYVGVGAKRVRELFAAARKQAP SIIFIDELDAIGQKRNARDAAHMRQTLNQLLVDLDGFSKNEDLAHPVVFIGATNFPESLD PALTRPGRFDRHIHVPLPDVRGRLAILLQHTRHVPLGKDVDLSIIARGTSGFAGADLANL INQAAVYASKNLSTAVSMRDLEWSKDRILMGAERKSAFITPENKLMTAYHEGGHALVALF TKNAMRPYKATIMPRGSSLGMTISLPDMDKDSWTREEYLAMLDVTMGGRAAEELLYGKDK ITSGAHNDIDKATQVARRMVTEFGMSDRIGPVSLEAEMDNLSPATRALVESEIKSLLEAS YERSLSLLKSHKKELDALATALVDYEFLTAEEMNRVVKGDRDLLRNKLS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SPCC965.04c recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,218 Da
NCBI Official Full Name
mitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted)
NCBI Official Symbol
SPCC965.04c
NCBI Protein Information
mitochondrial inner membrane i-AAA protease complex subunit Yme1 (predicted)
UniProt Protein Name
ATP-dependent zinc metalloprotease YME1 homolog
UniProt Gene Name
SPCC965.04c
UniProt Entry Name
YME1_SCHPO

Uniprot Description

Putative ATP-dependent protease.

Similar Products

Product Notes

The SPCC965.04c spcc965.04c (Catalog #AAA7040055) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-709aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SPCC965.04c spcc965.04c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRVLHPIFL FGKTSFLYSG CSKFGGRLFN NSIVHGWLRT RSYALASGLH PLRKQKLAHF EDLANANMSD PYMQAKLYKE LADNFPEAII SRYETQGVAR NSACDRYYQE ALRKKSWSRS LSNNISLSQS SSSPATSSFS DPKAFSAGVP KFTSDTSSTV SSTPSLNHSL QNSMPPSTPT PPPVWAPTIV SSALGTSSKT PVYVVVDEPR FTKFFRIFKF IAGLSVASYF VLLGMSIFAE TSGLNNIMTN TTEQEPMEER AINVRFSDVQ GVDEAKEELE EIVDFLRDPT HFTRLGGKLP RGVLLTGPPG TGKTMLARAV AGEANVPFFF MSGSQFDEMY VGVGAKRVRE LFAAARKQAP SIIFIDELDA IGQKRNARDA AHMRQTLNQL LVDLDGFSKN EDLAHPVVFI GATNFPESLD PALTRPGRFD RHIHVPLPDV RGRLAILLQH TRHVPLGKDV DLSIIARGTS GFAGADLANL INQAAVYASK NLSTAVSMRD LEWSKDRILM GAERKSAFIT PENKLMTAYH EGGHALVALF TKNAMRPYKA TIMPRGSSLG MTISLPDMDK DSWTREEYLA MLDVTMGGRA AEELLYGKDK ITSGAHNDID KATQVARRMV TEFGMSDRIG PVSLEAEMDN LSPATRALVE SEIKSLLEAS YERSLSLLKS HKKELDALAT ALVDYEFLTA EEMNRVVKGD RDLLRNKLS. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease YME1 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.