3-ketoacyl-CoA reductase Recombinant Protein | SNOG_13627 recombinant protein
Recombinant Phaeosphaeria nodorum 3-ketoacyl-CoA reductase (SNOG_13627)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA reductase; Recombinant Phaeosphaeria nodorum 3-ketoacyl-CoA reductase (SNOG_13627); SNOG_13627 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-341aa; full length protein
Sequence
MSSITETFGVRIDATNSLVQAAIYGFLLAGVAAFAAPIVSTIRVLLSLFVLPGKSLSSFG PRGTWALITGASDGIGKEFALALAAKGYNLILVSRTQSKLDSLAADISSKYGPKISTKTL AMDFAQNKDSDYNNLKKLVDGLDVSILINNVGLSHSIPVPFAETPKQEMTDIIMINCMAT LRVTQLLTPGMISRKRGLILTMASFGGFFPTPLLATYSGSKAFLQQWSSALGSELEPHGV HVQCVQSHLITTAMSKIRKPSALVPNPKQFVKATLSKLGRSGGAQNVAFTSTPYWSHGIM QWFLSRFLGERSPIVVKINRGMHEDIRRRALRKAERDAKKQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SNOG_13627 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,959 Da
NCBI Official Full Name
hypothetical protein SNOG_13627
NCBI Official Symbol
SNOG_13627
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Very-long-chain 3-oxoacyl-CoA reductase
UniProt Gene Name
SNOG_13627
UniProt Synonym Gene Names
3-ketoreductase; KAR
UniProt Entry Name
MKAR_PHANO
Uniprot Description
Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Similar Products
Product Notes
The SNOG_13627 snog_13627 (Catalog #AAA7039164) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-341aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SNOG_13627 snog_13627 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSITETFGV RIDATNSLVQ AAIYGFLLAG VAAFAAPIVS TIRVLLSLFV LPGKSLSSFG PRGTWALITG ASDGIGKEFA LALAAKGYNL ILVSRTQSKL DSLAADISSK YGPKISTKTL AMDFAQNKDS DYNNLKKLVD GLDVSILINN VGLSHSIPVP FAETPKQEMT DIIMINCMAT LRVTQLLTPG MISRKRGLIL TMASFGGFFP TPLLATYSGS KAFLQQWSSA LGSELEPHGV HVQCVQSHLI TTAMSKIRKP SALVPNPKQF VKATLSKLGR SGGAQNVAFT STPYWSHGIM QWFLSRFLGE RSPIVVKINR GMHEDIRRRA LRKAERDAKK Q. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
