Uncharacterized protein CG7816 Recombinant Protein | Zip99C recombinant protein
Recombinant Drosophila melanogaster Uncharacterized protein CG7816 (CG7816)
Gene Names
Zip99C; cg7816; CG7816; DmelCG7816; dZIP13; dZip99C
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein CG7816; Recombinant Drosophila melanogaster Uncharacterized protein CG7816 (CG7816); Zip99C recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-355aa; full length protein
Sequence
MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTE EKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWV LSGILIFTIVEKIFSGYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIE DVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILAT FAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTMLFEH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Zip99C recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,870 Da
NCBI Official Full Name
Zinc/iron regulated transporter-related protein 99C, isoform H
NCBI Official Synonym Full Names
Zinc/iron regulated transporter-related protein 99C
NCBI Official Symbol
Zip99C
NCBI Official Synonym Symbols
cg7816; CG7816; DmelCG7816; dZIP13; dZip99C
NCBI Protein Information
CG7816 gene product from transcript CG7816-RJ
UniProt Protein Name
Zinc transporter ZIP13 homolog
Protein Family
UniProt Gene Name
Zip99C
UniProt Entry Name
S39AD_DROME
Uniprot Description
Involved in zinc transport and homeostasis.
Similar Products
Product Notes
The Zip99C zip99c (Catalog #AAA7037497) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-355aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Zip99C zip99c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTNSSFFDE HIAMIYSNLM DQYMPEYFKS FEYTPWVFSL LGSVVIGLSG IFPLIIIPTE EKMAKEGYKD PADSKLLRVL LSFAVGGLLG DVFLHLLPEA WEGDNQDPSS HPSLRSGLWV LSGILIFTIV EKIFSGYASA DEENPQPKCV EIANCLLRRH GGQLPEGETS ESCGGACDIE DVGKVCFLRE QEQKSKERKE QPKKVAGYLN LLANSIDNFT HGLAVAGSFL VSFRHGILAT FAILLHEIPH EVGDFAILLR SGFSRWDAAR AQLLTAGAGL LGALVAIGGS GVTSAMEART SWIMPFTAGG FLHIALVTVL PDLLKEEERK ESIKQLLALV FGIALMAVMT MLFEH. It is sometimes possible for the material contained within the vial of "Uncharacterized protein CG7816, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
