ABC transporter ATP-binding protein YojI (yojI) Recombinant Protein | yojI recombinant protein
Recombinant Escherichia coli ABC transporter ATP-binding protein YojI (yojI)
Gene Names
yojI; ECK2203; JW2199; yojJ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ABC transporter ATP-binding protein YojI (yojI); Recombinant Escherichia coli ABC transporter ATP-binding protein YojI (yojI); yojI recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-547aa; full length protein
Sequence
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR DAVARTA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yojI recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,553 Da
NCBI Official Full Name
microcin J25 efflux ABC transporter permease/ATPase
NCBI Official Symbol
yojI
NCBI Official Synonym Symbols
ECK2203; JW2199; yojJ
NCBI Protein Information
microcin J25 efflux ABC transporter permease/ATPase
UniProt Protein Name
ABC transporter ATP-binding/permease protein YojI
Protein Family
UniProt Gene Name
yojI
UniProt Synonym Gene Names
yojJ
UniProt Entry Name
YOJI_ECOLI
NCBI Description
Overexpressed YojI confers Microcin J25 resistance and a yojI mutation confers Microcin J25 sensistivity. [More information is available at EcoGene: EG12070]. YojI is a member of the ABC superfamily of transporters . [More information is available at EcoCyc: EG12070].
Uniprot Description
Mediates resistance to the antibacterial peptide microcin J25, when expressed from a multicopy vector. Functions as an efflux pump for microcin J25, with the help of the outer membrane channel TolC.
Research Articles on yojI
Similar Products
Product Notes
The yojI yoji (Catalog #AAA7035350) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-547aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yojI yoji for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELLVLVWRQ YRWPFISVMA LSLASAALGI GLIAFINQRL IETADTSLLV LPEFLGLLLL LMAVTLGSQL ALTTLGHHFV YRLRSEFIKR ILDTHVERIE QLGSASLLAG LTSDVRNITI AFVRLPELVQ GIILTIGSAA YLWMLSGKML LVTAIWMAIT IWGGFVLVAR VYKHMATLRE TEDKLYTDFQ TVLEGRKELT LNRERAEYVF NNLYIPDAQE YRHHIIRADT FHLSAVNWSN IMMLGAIGLV FWMANSLGWA DTNVAATYSL TLLFLRTPLL SAVGALPTLL TAQVAFNKLN KFALAPFKAE FPRPQAFPNW QTLELRNVTF AYQDNAFSVG PINLTIKRGE LLFLIGGNGS GKSTLAMLLT GLYQPQSGEI LLDGKPVSGE QPEDYRKLFS AVFTDVWLFD QLLGPEGKPA NPQLVEKWLA QLKMAHKLEL SNGRIVNLKL SKGQKKRVAL LLALAEERDI ILLDEWAADQ DPHFRREFYQ VLLPLMQEMG KTIFAISHDD HYFIHADRLL EMRNGQLSEL TGEERDAASR DAVARTA. It is sometimes possible for the material contained within the vial of "ABC transporter ATP-binding protein YojI (yojI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
