Mitochondrial escape protein 2 (YME2) Recombinant Protein | YME2 recombinant protein
Recombinant Kluyveromyces lactis Mitochondrial escape protein 2 (YME2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial escape protein 2 (YME2); Recombinant Kluyveromyces lactis Mitochondrial escape protein 2 (YME2); YME2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
31-808aa; full length protein
Sequence
VSSEIQQKDEQAGESNTATDTGIIHKTEQETLIYFDNVYPRAMSLWSPTQWYNLLMSNQT RNAVRAKIFKFANPPDNPIHNLELRSTIPIKRDGGVFATFLVPPNYTTAEVNAMIQKNTQ QESSKSWFSFFTEVTAFPVKGSPWIEDLRRLPSNQIRVKFEGGFLTEEEVYALFRRYGTI INIYPNPKEMTYLISYRSFRGAICAKNCVSGMEVHNSIIHVQYEQLTQGHVISDFFVNHT RIAVPLLLALLSILAVIVFDPIREFTIEQKITHKYSLSWDNYFLKKILSVTSSTMSSVKE YWGITDRHVQKRQLWEERQEKVADLKLWLQENNNTFVVLRGPRGSGKHELVMQHTLHDRP NVLYLDCDKLIKSRTDAKFLRNAASQLGYFPIFPWVNSVTNLLDLAVQGLTGQKSGLSES KELQFRNMLSTAMMSIRHIALKGYKPVIGSGDSIINVKEEDYLQQHPEKKPVIVIDRFNN RAEMNGFVYKELSDWAAMLVQMNLAHVIFLTETVSPNQLLAESLPNQVFKMMTLSDASKK SARRYVLAQLQETTEDDDDIDTSKPLDLNEKFVHEIDDSLDPIGGRMLDLQAFVRRVKSG EQPKEALEKMVEQASEQITQIFLSGSADPLRGAQAWELIELLSANGSIRFRDIIYRPLFK AAPEAALLDLEKNGFVTMTRDRGVLTDIYPAKPLFCAAFQYLLNNKEMYNVLRTSYLLRM VTFETGRIKKWEEELRALGKVSDQKMFRSRLAYLAGKIDASSAAIDDCESEVKELSKK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for YME2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92,635 Da
NCBI Official Full Name
hypothetical protein
NCBI Official Symbol
KLLA0C13948g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Mitochondrial escape protein 2
Protein Family
UniProt Gene Name
YME2
UniProt Entry Name
YME2_KLULA
Uniprot Description
Plays a role in maintaining the mitochondrial genome and in controlling the mtDNA escape. Involved in the regulation of mtDNA nucleotide structure and number. May have a dispensable role in early maturation of pre-rRNA ().
Similar Products
Product Notes
The YME2 yme2 (Catalog #AAA7035177) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-808aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the YME2 yme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSSEIQQKDE QAGESNTATD TGIIHKTEQE TLIYFDNVYP RAMSLWSPTQ WYNLLMSNQT RNAVRAKIFK FANPPDNPIH NLELRSTIPI KRDGGVFATF LVPPNYTTAE VNAMIQKNTQ QESSKSWFSF FTEVTAFPVK GSPWIEDLRR LPSNQIRVKF EGGFLTEEEV YALFRRYGTI INIYPNPKEM TYLISYRSFR GAICAKNCVS GMEVHNSIIH VQYEQLTQGH VISDFFVNHT RIAVPLLLAL LSILAVIVFD PIREFTIEQK ITHKYSLSWD NYFLKKILSV TSSTMSSVKE YWGITDRHVQ KRQLWEERQE KVADLKLWLQ ENNNTFVVLR GPRGSGKHEL VMQHTLHDRP NVLYLDCDKL IKSRTDAKFL RNAASQLGYF PIFPWVNSVT NLLDLAVQGL TGQKSGLSES KELQFRNMLS TAMMSIRHIA LKGYKPVIGS GDSIINVKEE DYLQQHPEKK PVIVIDRFNN RAEMNGFVYK ELSDWAAMLV QMNLAHVIFL TETVSPNQLL AESLPNQVFK MMTLSDASKK SARRYVLAQL QETTEDDDDI DTSKPLDLNE KFVHEIDDSL DPIGGRMLDL QAFVRRVKSG EQPKEALEKM VEQASEQITQ IFLSGSADPL RGAQAWELIE LLSANGSIRF RDIIYRPLFK AAPEAALLDL EKNGFVTMTR DRGVLTDIYP AKPLFCAAFQ YLLNNKEMYN VLRTSYLLRM VTFETGRIKK WEEELRALGK VSDQKMFRSR LAYLAGKIDA SSAAIDDCES EVKELSKK. It is sometimes possible for the material contained within the vial of "Mitochondrial escape protein 2 (YME2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
