Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Stimulator of interferon genes protein (Tmem173) Recombinant Protein | Tmem173 recombinant protein

Recombinant Mouse Stimulator of interferon genes protein (Tmem173)

Gene Names
Tmem173; ERIS; MPYS; Mita; STING; 2610307O08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Stimulator of interferon genes protein (Tmem173); Recombinant Mouse Stimulator of interferon genes protein (Tmem173); Tmem173 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-378. Full Length
Sequence
MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tmem173 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.9 kDa
NCBI Official Full Name
stimulator of interferon genes protein isoform 2
NCBI Official Synonym Full Names
transmembrane protein 173
NCBI Official Symbol
Tmem173
NCBI Official Synonym Symbols
ERIS; MPYS; Mita; STING; 2610307O08Rik
NCBI Protein Information
stimulator of interferon genes protein
UniProt Protein Name
Stimulator of interferon genes protein
UniProt Gene Name
Tmem173
UniProt Synonym Gene Names
Eris Mita; Mpys; Sting; mSTING; ERIS; MMITA
UniProt Entry Name
STING_MOUSE

Uniprot Description

TMEM173: Facilitator of innate immune signaling that promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double- stranded DNA from viruses and bacteria delivered to the cytoplasm. Able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti- viral state following expression. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Associates with the MHC-II complex. Homodimer; 'Lys-63'-linked ubiquitination at Lys-150 is required for homodimerization. Interacts with DDX58/RIG-I, MAVS/VISA and SSR2. Interacts with RNF5 and TRIM56. Interacts with TBK1; when homodimer, leading to subsequent production of IFN-beta. Ubiquitously expressed. Belongs to the TMEM173 family.

Protein type: Membrane protein, multi-pass; Endoplasmic reticulum; Apoptosis; Membrane protein, integral; Mitochondrial

Cellular Component: cytoplasm; endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; integral to membrane; membrane; mitochondrial outer membrane; mitochondrion; perinuclear region of cytoplasm; peroxisome; plasma membrane

Molecular Function: identical protein binding; nucleotide binding; protein binding; protein homodimerization activity; protein kinase binding; transcription factor binding; ubiquitin protein ligase binding

Biological Process: activation of innate immune response; apoptosis; defense response to virus; immune system process; innate immune response; interferon-beta production; positive regulation of defense response to virus by host; positive regulation of interferon type I production; positive regulation of protein binding; positive regulation of protein import into nucleus, translocation; positive regulation of transcription factor import into nucleus; positive regulation of transcription from RNA polymerase II promoter

Research Articles on Tmem173

Similar Products

Product Notes

The Tmem173 tmem173 (Catalog #AAA7031575) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-378. Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tmem173 tmem173 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPYSNLHPAI PRPRGHRSKY VALIFLVASL MILWVAKDPP NHTLKYLALH LASHELGLLL KNLCCLAEEL CHVQSRYQGS YWKAVRACLG CPIHCMAMIL LSSYFYFLQN TADIYLSWMF GLLVLYKSLS MLLGLQSLTP AEVSAVCEEK KLNVAHGLAW SYYIGYLRLI LPGLQARIRM FNQLHNNMLS GAGSRRLYIL FPLDCGVPDN LSVVDPNIRF RDMLPQQNID RAGIKNRVYS NSVYEILENG QPAGVCILEY ATPLQTLFAM SQDAKAGFSR EDRLEQAKLF CRTLEEILED VPESRNNCRL IVYQEPTDGN SFSLSQEVLR HIRQEEKEEV TMNAPMTSVA PPPSVLSQEP RLLISGMDQP LPLRTDLI . It is sometimes possible for the material contained within the vial of "Stimulator of interferon genes protein (Tmem173), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.