Transmembrane protein 163 (Tmem163) Recombinant Protein | Tmem163 recombinant protein
Recombinant Rat Transmembrane protein 163 (Tmem163)
Gene Names
Tmem163; Sv31; RGD1306212
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 163 (Tmem163); Recombinant Rat Transmembrane protein 163 (Tmem163); Tmem163 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-288aa; full length protein
Sequence
MERAPGSERRSPPGPGVPRPPPRGHAPSTAAPAPNPAPLSSSMQPDEERQPRISESGQFS DGFEDRGLLESSTRLKPHEAQNYRKKALWVSWLSIIVTLALAVAAFTVSVMRYSASAFGF AFDAILDVLSSAIVLWRYSNAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRL LPEVDDFLFSVSILSGILCSVLAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSAE VFKHNAAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tmem163 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,344 Da
NCBI Official Full Name
transmembrane protein 163
NCBI Official Synonym Full Names
transmembrane protein 163
NCBI Official Symbol
Tmem163
NCBI Official Synonym Symbols
Sv31; RGD1306212
NCBI Protein Information
transmembrane protein 163
UniProt Protein Name
Transmembrane protein 163
Protein Family
UniProt Gene Name
Tmem163
UniProt Synonym Gene Names
Sv31
UniProt Entry Name
TM163_RAT
Uniprot Description
TMEM163: May bind zinc and other divalent cations and recruit them to vesicular organelles. Belongs to the TMEM163 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: cell junction; early endosome membrane; integral to synaptic vesicle membrane; synaptic vesicle membrane
Molecular Function: zinc ion binding
Research Articles on Tmem163
Similar Products
Product Notes
The Tmem163 tmem163 (Catalog #AAA7031545) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-288aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tmem163 tmem163 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERAPGSERR SPPGPGVPRP PPRGHAPSTA APAPNPAPLS SSMQPDEERQ PRISESGQFS DGFEDRGLLE SSTRLKPHEA QNYRKKALWV SWLSIIVTLA LAVAAFTVSV MRYSASAFGF AFDAILDVLS SAIVLWRYSN AAAVHSAHRE YIACVILGVI FLLSSICIVV KAIHDLSTRL LPEVDDFLFS VSILSGILCS VLAVLKFMLG KVLTSRALIT DGFNSLVGGV MGFSILLSAE VFKHNAAVWY LDGSIGVLIG LTIFAYGVKL LIDMVPRVRQ TRHYEMFE. It is sometimes possible for the material contained within the vial of "Transmembrane protein 163 (Tmem163), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
