Transmembrane protein 120A (Tmem120a) Recombinant Protein | Tmem120a recombinant protein
Recombinant Rat Transmembrane protein 120A (Tmem120a)
Gene Names
Tmem120a; Tmpit; RGD1311474
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 120A (Tmem120a); Recombinant Rat Transmembrane protein 120A (Tmem120a); Tmem120a recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-343aa; full length protein
Sequence
MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRVKLEELTKLQDNCTNSITRQKKRLQE LALVLKKCRPSLPSESLEAAQELESQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP ECKEWQVLMCGLPFLLLFLGNFFTTLRVVHQKFHSQQHGSKKD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Tmem120a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,657 Da
NCBI Official Full Name
transmembrane protein 120A
NCBI Official Synonym Full Names
transmembrane protein 120A
NCBI Official Symbol
Tmem120a
NCBI Official Synonym Symbols
Tmpit; RGD1311474
NCBI Protein Information
transmembrane protein 120A
UniProt Protein Name
Transmembrane protein 120A
Protein Family
UniProt Gene Name
Tmem120a
UniProt Synonym Gene Names
Tmpit
UniProt Entry Name
T120A_RAT
Uniprot Description
TMEM120A: Belongs to the TMEM120 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass
Cellular Component: integral to membrane; nuclear inner membrane
Biological Process: fat cell differentiation; protein heterooligomerization; protein homooligomerization
Similar Products
Product Notes
The Tmem120a tmem120a (Catalog #AAA7031437) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-343aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Tmem120a tmem120a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQSPPPDPLG DCLRNWEDLQ QDFQGIQETH RLYRVKLEEL TKLQDNCTNS ITRQKKRLQE LALVLKKCRP SLPSESLEAA QELESQIKER QGLFFDMEAY LPKKNGLYLS LVLGNVNVTL LSKQAKFAYK DEYEKFKLYL TIILIVISFT CRFLLNSRVT DAAFNFLLVW YYCTLTIRES ILINNGSRIK GWWVFHHYVS TFLSGVMLTW PDGLMYQKFR NQFLSFSMYQ SFVQFLQYYY QSGCLYRLRA LGERHTMDLT VEGFQSWMWR GLTFLLPFLF FGHFWQLFNA LTLFNLARDP ECKEWQVLMC GLPFLLLFLG NFFTTLRVVH QKFHSQQHGS KKD. It is sometimes possible for the material contained within the vial of "Transmembrane protein 120A (Tmem120a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
