Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50) Recombinant Protein | TIMM50 recombinant protein
Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50)
Gene Names
TIMM50; TIM50
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50); Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50); TIMM50 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
45-353aa; full length protein
Sequence
STKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDN DPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHLEWS LATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATR YMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLK TIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTS RLWPRSKQP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TIMM50 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,603 Da
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit TIM50
NCBI Official Symbol
TIMM50
NCBI Official Synonym Symbols
TIM50
NCBI Protein Information
mitochondrial import inner membrane translocase subunit TIM50
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM50
Protein Family
UniProt Gene Name
TIMM50
UniProt Synonym Gene Names
TIM50
UniProt Entry Name
TIM50_PONAB
Uniprot Description
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Similar Products
Product Notes
The TIMM50 timm50 (Catalog #AAA7031271) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-353aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TIMM50 timm50 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: STKAQGPQQQ PGSEGPSYAK KVALWLAGLL GAGGTVSVVY IFGNNPVDEN GAKIPDEFDN DPILVQQLRR TYKYFKDYRQ MIIEPTSPCL LPDPLQEPYY QPPYTLVLEL TGVLLHLEWS LATGWRFKKR PGIETLFQQL APLYEIVIFT SETGMTAFPL IDSVDPHGFI SYRLFRDATR YMDGHHVKDI SCLNRDPARV VVVDCKKEAF RLQPYNGVAL RPWDGNSDDR VLLDLSAFLK TIALNGVEDV RTVLEHYALE DDPLAAFKQR QSRLEQEEQQ RLAELSKSNK QNLFLGSLTS RLWPRSKQP. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
