E3 ubiquitin-protein ligase synoviolin (syvn1) Recombinant Protein | syvn1 recombinant protein
Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1)
Gene Names
syvn1; zgc:55735; zgc:77108; wu:fk91f10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase synoviolin (syvn1); Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1); syvn1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-625aa; full length protein
Sequence
HAYFLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKLMRKVFFGQLRAAEMEHLIER SWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWVFHFR VLSLMVLLGVMDFLFVNHACHSIITRGASVQLVFGFEYAILMTMVLTTFIKYTLHTIDLQ SENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVT DAIMSRRAIRNMNTLYPDATPEDLQATDNVCIICREEMVTGAKKLPCNHIFHSSCLRSWF QRQQTCPTCRMDVLRASQPNQTPAPPAAQAPAPPAPANAPIPPPVNVAPGMIPQFPPGLF PFWGPFPGAPPPAVPGAPAAPTDTPQPSSDGAQGAESGAGGLAQSTAEAASAAPGAMPGF PFTMPPPFPSAPWLPMPPPPPFMSSMPPPPSSLSSMSEAELRELEQEGRRGLEARLQCLH NIHTLLDAAMLNIHHYLSTVATLSPPRSETNTGETSESANVESSPSTANTETAGQEIQSQ SGESINGAAGFSQPDSTTEGEKDVKEEDEDDGEPSAAELRRRRLRKLETTNTPDHGNLLK LASVN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for syvn1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
68,757 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase synoviolin
NCBI Official Synonym Full Names
synovial apoptosis inhibitor 1, synoviolin
NCBI Official Symbol
syvn1
NCBI Official Synonym Symbols
zgc:55735; zgc:77108; wu:fk91f10
NCBI Protein Information
E3 ubiquitin-protein ligase synoviolin
UniProt Protein Name
E3 ubiquitin-protein ligase synoviolin
Protein Family
UniProt Gene Name
syvn1
UniProt Synonym Gene Names
hrd1
UniProt Entry Name
SYVN1_DANRE
Uniprot Description
Acts as an E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Also promotes the degradation of normal but naturally short-lived proteins. Protects cells from ER stress-induced apoptosis. Sequesters p53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation and apoptosis ().
Similar Products
Product Notes
The syvn1 syvn1 (Catalog #AAA7030778) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-625aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the syvn1 syvn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HAYFLKHQFY PTVVYLTKSS PSMAVLYIQA FVLVFLLGKL MRKVFFGQLR AAEMEHLIER SWYAVTETCL AFTVFRDDFS PRFVALFTLL LFLKCFHWLA EDRVDFMERS PNISWVFHFR VLSLMVLLGV MDFLFVNHAC HSIITRGASV QLVFGFEYAI LMTMVLTTFI KYTLHTIDLQ SENPWDNKAV YMLYTELFTG FIKVLLYMAF MTIMIKVHTF PLFAIRPMYL AMRQFKKAVT DAIMSRRAIR NMNTLYPDAT PEDLQATDNV CIICREEMVT GAKKLPCNHI FHSSCLRSWF QRQQTCPTCR MDVLRASQPN QTPAPPAAQA PAPPAPANAP IPPPVNVAPG MIPQFPPGLF PFWGPFPGAP PPAVPGAPAA PTDTPQPSSD GAQGAESGAG GLAQSTAEAA SAAPGAMPGF PFTMPPPFPS APWLPMPPPP PFMSSMPPPP SSLSSMSEAE LRELEQEGRR GLEARLQCLH NIHTLLDAAM LNIHHYLSTV ATLSPPRSET NTGETSESAN VESSPSTANT ETAGQEIQSQ SGESINGAAG FSQPDSTTEG EKDVKEEDED DGEPSAAELR RRRLRKLETT NTPDHGNLLK LASVN. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase synoviolin (syvn1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
