Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Signal recognition particle receptor subunit beta (Srprb) Recombinant Protein | Srprb recombinant protein

Recombinant Mouse Signal recognition particle receptor subunit beta (Srprb)

Gene Names
Srprb; AA409543
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Signal recognition particle receptor subunit beta (Srprb); Recombinant Mouse Signal recognition particle receptor subunit beta (Srprb); Srprb recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-269aa; Full length protein
Sequence
MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAVLLTLVFWKFIWSRKS SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE SLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLIACNKQ DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE FLECSAKGGRGDTGSADIQDLEKWLAKIA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Srprb recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,579 Da
NCBI Official Full Name
signal recognition particle receptor subunit beta
NCBI Official Synonym Full Names
signal recognition particle receptor, B subunit
NCBI Official Symbol
Srprb
NCBI Official Synonym Symbols
AA409543
NCBI Protein Information
signal recognition particle receptor subunit beta
UniProt Protein Name
Signal recognition particle receptor subunit beta
UniProt Gene Name
Srprb
UniProt Synonym Gene Names
SR-beta
UniProt Entry Name
SRPRB_MOUSE

Uniprot Description

SRPRB: Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR. Belongs to the SRP receptor beta subunit family.

Protein type: Membrane protein, integral

Cellular Component: cytoplasm; cytoplasmic microtubule; endoplasmic reticulum; integral to membrane; intracellular; membrane

Molecular Function: GTP binding; nucleotide binding; ubiquitin protein ligase binding

Biological Process: small GTPase mediated signal transduction

Similar Products

Product Notes

The Srprb srprb (Catalog #AAA7030503) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-269aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Srprb srprb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASANTRRVG DGAGGAFQPY LDSLRQELQQ RDPTLLSVAV ALLAVLLTLV FWKFIWSRKS SQRAVLFVGL CDSGKTLLFV RLLTGQYRDT QTSITDSSAI YKVNNNRGNS LTLIDLPGHE SLRFQLLDRF KSSARAVVFV VDSAAFQREV KDVAEFLYQV LIDSMALKNS PSLLIACNKQ DIAMAKSAKL IQQQLEKELN TLRVTRSAAP STLDSSSTAP AQLGKKGKEF EFSQLPLKVE FLECSAKGGR GDTGSADIQD LEKWLAKIA. It is sometimes possible for the material contained within the vial of "Signal recognition particle receptor subunit beta (Srprb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual