Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Long-chain fatty acid transport protein 6 (SLC27A6) Recombinant Protein | SLC27A6 recombinant protein

Recombinant Human Long-chain fatty acid transport protein 6 (SLC27A6)

Gene Names
SLC27A6; FATP6; ACSVL2; FACVL2; VLCS-H1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Long-chain fatty acid transport protein 6 (SLC27A6); Recombinant Human Long-chain fatty acid transport protein 6 (SLC27A6); SLC27A6 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-619aa; full length protein
Sequence
MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKF LSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVH VWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVW GMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDC KKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCEL YAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRT GDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEK VYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS YVLLTRELYDQIMLGEIKL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SLC27A6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,112 Da
NCBI Official Full Name
long-chain fatty acid transport protein 6
NCBI Official Synonym Full Names
solute carrier family 27 member 6
NCBI Official Symbol
SLC27A6
NCBI Official Synonym Symbols
FATP6; ACSVL2; FACVL2; VLCS-H1
NCBI Protein Information
long-chain fatty acid transport protein 6
UniProt Protein Name
Long-chain fatty acid transport protein 6
UniProt Gene Name
SLC27A6
UniProt Synonym Gene Names
ACSVL2; FACVL2; FATP1; FATP-6; Fatty acid transport protein 6; VLCSH1; hVLCS-H1
UniProt Entry Name
S27A6_HUMAN

NCBI Description

This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC27A6: Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Thought to function as the predominant fatty acid protein transporter in heart. Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Endoplasmic reticulum; Transporter, SLC family; Ligase; Transporter

Chromosomal Location of Human Ortholog: 5q23.3

Cellular Component: integral to membrane; plasma membrane; sarcolemma

Molecular Function: fatty acid transporter activity; long-chain-fatty-acid-CoA ligase activity; nucleotide binding; very-long-chain-fatty-acid-CoA ligase activity

Biological Process: long-chain fatty acid metabolic process; long-chain fatty acid transport; very-long-chain fatty acid metabolic process

Research Articles on SLC27A6

Similar Products

Product Notes

The SLC27A6 slc27a6 (Catalog #AAA7030040) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-619aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SLC27A6 slc27a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLSWLTVLG AGMVVLHFLQ KLLFPYFWDD FWFVLKVVLI IIRLKKYEKR GELVTVLDKF LSHAKRQPRK PFIIYEGDIY TYQDVDKRSS RVAHVFLNHS SLKKGDTVAL LMSNEPDFVH VWFGLAKLGC VVAFLNTNIR SNSLLNCIRA CGPRALVVGA DLLGTVEEIL PSLSENISVW GMKDSVPQGV ISLKEKLSTS PDEPVPRSHH VVSLLKSTCL YIFTSGTTGL PKAAVISQLQ VLRGSAVLWA FGCTAHDIVY ITLPLYHSSA AILGISGCVE LGATCVLKKK FSASQFWSDC KKYDVTVFQY IGELCRYLCK QSKREGEKDH KVRLAIGNGI RSDVWREFLD RFGNIKVCEL YAATESSISF MNYTGRIGAI GRTNLFYKLL STFDLIKYDF QKDEPMRNEQ GWCIHVKKGE PGLLISRVNA KNPFFGYAGP YKHTKDKLLC DVFKKGDVYL NTGDLIVQDQ DNFLYFWDRT GDTFRWKGEN VATTEVADVI GMLDFIQEAN VYGVAISGYE GRAGMASIIL KPNTSLDLEK VYEQVVTFLP AYACPRFLRI QEKMEATGTF KLLKHQLVED GFNPLKISEP LYFMDNLKKS YVLLTRELYD QIMLGEIKL. It is sometimes possible for the material contained within the vial of "Long-chain fatty acid transport protein 6 (SLC27A6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.