Long-chain fatty acid transport protein 4 (SLC27A4) Recombinant Protein | SLC27A4 recombinant protein
Recombinant Pongo abelii Long-chain fatty acid transport protein 4 (SLC27A4)
Gene Names
SLC27A4; FATP4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Long-chain fatty acid transport protein 4 (SLC27A4); Recombinant Pongo abelii Long-chain fatty acid transport protein 4 (SLC27A4); SLC27A4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-643aa; full length protein
Sequence
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL KVKAKVRQCLRERRTVPILFASTVRRHPDKTALIFEGTDTLWTFRQLDEYSSSVANFLQA RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDAQLHCLTTSRARALVFG SEMASAICEIHASLDPSLSLFCSGSWEPNAVPTSTEHLDPLLKDAPKHLPICPDKGFTDK LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR VNEDTMELIRGPDGICIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANDKKIAKDVFKK GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE LRKEGFDPAIVKDPLFYLDARKGRYVPLDQEAYSRIQAGEEKL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SLC27A4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,228 Da
NCBI Official Full Name
long-chain fatty acid transport protein 4
NCBI Official Symbol
SLC27A4
NCBI Official Synonym Symbols
FATP4
NCBI Protein Information
long-chain fatty acid transport protein 4
UniProt Protein Name
Long-chain fatty acid transport protein 4
Protein Family
UniProt Gene Name
SLC27A4
UniProt Synonym Gene Names
FATP4; FATP-4; Fatty acid transport protein 4
UniProt Entry Name
S27A4_PONAB
Uniprot Description
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids (VLCFAs). Indirectly inhibits RPE65 via substrate competition and via production of VLCFA derivatives like lignoceroyl-CoA. Prevents light-induced degeneration of rods and cones ().
Similar Products
Product Notes
The SLC27A4 slc27a4 (Catalog #AAA7030037) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-643aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SLC27A4 slc27a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLGASLVGV LLFSKLVLKL PWTQVGFSLL FLYLGSGGWR FIRVFIKTIR RDIFGGLVLL KVKAKVRQCL RERRTVPILF ASTVRRHPDK TALIFEGTDT LWTFRQLDEY SSSVANFLQA RGLASGDVAA IFMENRNEFV GLWLGMAKLG VEAALINTNL RRDAQLHCLT TSRARALVFG SEMASAICEI HASLDPSLSL FCSGSWEPNA VPTSTEHLDP LLKDAPKHLP ICPDKGFTDK LFYIYTSGTT GLPKAAIVVH SRYYRMAALV YYGFRMRPND IVYDCLPLYH SAGNIVGIGQ CLLHGMTVVI RKKFSASRFW DDCIKYNCTI VQYIGELCRY LLNQPPREAE NQHQVRMALG NGLRQSIWTN FSSRFHIPQV AEFYGATECN CSLGNFDSQV GACGFNSRIL SFVYPIRLVR VNEDTMELIR GPDGICIPCQ PGEPGQLVGR IIQKDPLRRF DGYLNQGAND KKIAKDVFKK GDQAYLTGDV LVMDELGYLY FRDRTGDTFR WKGENVSTTE VEGTLSRLLD MADVAVYGVE VPGTEGRAGM AAVASPTGNC DLERFAQVLE KELPLYARPI FLRLLPELHK TGTYKFQKTE LRKEGFDPAI VKDPLFYLDA RKGRYVPLDQ EAYSRIQAGE EKL. It is sometimes possible for the material contained within the vial of "Long-chain fatty acid transport protein 4 (SLC27A4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
