Relaxin receptor 2 (Rxfp2) Recombinant Protein | Rxfp2 recombinant protein
Recombinant Mouse Relaxin receptor 2 (Rxfp2)
Gene Names
Rxfp2; Lgr8; Great; Gpr106
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Relaxin receptor 2 (Rxfp2); Recombinant Mouse Relaxin receptor 2 (Rxfp2); Rxfp2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-737aa; full length protein
Sequence
MWLLLHVILLTEVKDFALADSSMVAPLCPKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE DNCGDTSGWTTIFGTVHGNVNKVTLTQECFLSQYPQHCYCRENELECVKADLKAVPKVSS NVTLLSLKKNKIHRLPVKVFSRYTELRKIYLQHNCITHISRRAFLGLHNLQILYLSHNCI TSLRPGIFKDLHQLAWLILDDNPITRISQKSFMGLNSLFFLSMVGNRLEALPETLCAQMP QLNWVDLANNGIKYITNSTFLTCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNMI TKLPVHLFSDLHLLQKLNLSSNPLLYVHKNQFGSLKQLQSLDLERIEIPNISTGMFQPMK NLSHIYLKTFRYCSYVPHVRICMPSTDGISSSEDLLANGILRVSVWVIAFITCVGNFLVI AVRSLIKAENTTHAMSIKILCCADCLMGVYLFSVGVFDIKYRGQYQKYALLWMESVPCRL LGFLATLSTEVSVLLLTFLTLEKFLVIVFPFSNLRLGKRQTAVALASIWVVGFLIAAVPF TREDYFGNFYGKNGVCFPLHYDQAEDFGSRGYSLGIFLGVNLLAFLVIVISYVTMFCSIH KTALQTAEVRSHIGKEVAVANRFFFIVFSDAICWIPVFVVKILSLLQVEIPGTITSWIVV FFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKPIFKVKKKSLSASIVWTDESSLKLG VLSKIALGDSIMKPVSP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rxfp2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,934 Da
NCBI Official Full Name
relaxin receptor 2 isoform 2
NCBI Official Synonym Full Names
relaxin/insulin-like family peptide receptor 2
NCBI Official Symbol
Rxfp2
NCBI Official Synonym Symbols
Lgr8; Great; Gpr106
NCBI Protein Information
relaxin receptor 2
UniProt Protein Name
Relaxin receptor 2
Protein Family
UniProt Gene Name
Rxfp2
UniProt Synonym Gene Names
Gpr106; Great; Lgr8
UniProt Entry Name
RXFP2_MOUSE
Uniprot Description
LGR8: the relaxin receptor is a G-protein coupled receptor (GPCR) that leads to the stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3).
Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: integral to membrane; membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; peptide hormone binding; protein-hormone receptor activity; signal transducer activity
Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; G-protein signaling, adenylate cyclase inhibiting pathway; male gonad development; negative regulation of apoptosis; negative regulation of cell proliferation; oocyte maturation; positive regulation of cAMP biosynthetic process; signal transduction
Research Articles on Rxfp2
1. data suggest a novel role for Rln in craniofacial skeletal development and metabolism through Rxfp2
Similar Products
Product Notes
The Rxfp2 rxfp2 (Catalog #AAA7029194) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-737aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rxfp2 rxfp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWLLLHVILL TEVKDFALAD SSMVAPLCPK GYFPCGNLTK CLPRAFHCDG VDDCGNGADE DNCGDTSGWT TIFGTVHGNV NKVTLTQECF LSQYPQHCYC RENELECVKA DLKAVPKVSS NVTLLSLKKN KIHRLPVKVF SRYTELRKIY LQHNCITHIS RRAFLGLHNL QILYLSHNCI TSLRPGIFKD LHQLAWLILD DNPITRISQK SFMGLNSLFF LSMVGNRLEA LPETLCAQMP QLNWVDLANN GIKYITNSTF LTCDSLTVLF LPRNQIGFVP EKTFSSLKNL GELDLSSNMI TKLPVHLFSD LHLLQKLNLS SNPLLYVHKN QFGSLKQLQS LDLERIEIPN ISTGMFQPMK NLSHIYLKTF RYCSYVPHVR ICMPSTDGIS SSEDLLANGI LRVSVWVIAF ITCVGNFLVI AVRSLIKAEN TTHAMSIKIL CCADCLMGVY LFSVGVFDIK YRGQYQKYAL LWMESVPCRL LGFLATLSTE VSVLLLTFLT LEKFLVIVFP FSNLRLGKRQ TAVALASIWV VGFLIAAVPF TREDYFGNFY GKNGVCFPLH YDQAEDFGSR GYSLGIFLGV NLLAFLVIVI SYVTMFCSIH KTALQTAEVR SHIGKEVAVA NRFFFIVFSD AICWIPVFVV KILSLLQVEI PGTITSWIVV FFLPVNSALN PILYTLTTSF FKDKLKQLLH KHRRKPIFKV KKKSLSASIV WTDESSLKLG VLSKIALGDS IMKPVSP. It is sometimes possible for the material contained within the vial of "Relaxin receptor 2 (Rxfp2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
